LOCAL TSUNAMI WARNING AND MITIGATION ________________________________________________________________________________________________________________________________________ PROBABILISTIC ANALYSES OF LANDSLIDE TSUNAMI HAZARDS Philip Watts Applied Fluids Engineering, Inc., ... Throughout the Pacific, tsunami amplitude and earthquake magnitude records acquired during the 1990s suggest that submarine mass failures generate the maximum tsunami amplitude in around 30% of events [Watts, 2002]. ...

Еще в разделе: (Показать все результаты (>23) - seac47-2.phys.msu.ru/ )

• http://seac47-2.phys.msu.ru/proc/E01_Armigliato.pdf
• http://seac47-2.phys.msu.ru/proc/E21_Stromkov.pdf
• http://seac47-2.phys.msu.ru/proc/E12_Marchuk.pdf

... Main practical applications of X-rays lie in the important for the society fields of medical imaging, custom, transport inspection and security. Scientific applications besides of fundamental research include material sciences, biomicroscopy, and protein crystallography. ... The first are relatively cheap, robust, and compact but have low brightness and poorly controlled photon spectrum. ... So accelerator based X- ray sources are mainly still used for scientific applications and X-ray tubes ? ...

Еще в разделе: (Показать все результаты (>8) - miles.sinp.msu.ru/ )

• Thomson Electron X-Ray Source for Medical Applications | Проект ЭЛЛАРИ

... 6, February, 2015 SESSIONS OF THE WORKSHOP OF THE MATHEMATICS AND MECHANICS DEPARTMENT OF LOMONOSOV MOSCOW STATE UNIVERSITY, "URGENT PROBLEMS OF GEOMETRY AND MECHANICS" NAMED AFTER V. V. TROFIMOV D. V. Georgievskii and M. V. Shamolin UDC 51(09) (For the b eginning of the list of sessions see J. Math. ... For these coefficients, we construct a recurrent system of ordinary differential equations. ... Some problems of microp olar elasticity theory. ... Stability of nonconservative mechanical systems. ...

Еще в разделе: (Показать все результаты (>35) - shamolin2.imec.msu.ru/ )

• Заседание 320 (совместное заседание с семинаром механико-математического
• Mathematical Reviews

... The detectors used in the setup had efficiency three orders of magnitude better than ones used before. ... As a result, effect of nonlocal influences of several largescale processes related with the weather changes, the geomagnetic variations, the ionospheric and solar activity have reliable been detected. ... йи з ед гв б 7 (2) (3) (4) All known local factors influencing on : temperature, pressure, chemism, illumination, electric field etc. must be excluded or stabilised. ...

Еще в разделе: (Показать все результаты (>14) - temporology.bio.msu.ru/ )

• Лаборатория-кафедра причинной механики

Head of sector, acting head of the Computational Geophysics Division of the M.V. Keldysh Institute for Applied Mathematics, RAS. ... Finished the Electrodynamics and Quantum Theory Department of Faculty of Physics, MSU in 1962. ... Ill-posed problems, stochastic processes, theory of approximation. Mechanics and physics of multi-phase media, phenomena in porous media, difference schemes for some classes of mathematical physics problems (filtration, elasticity theory). ...

Еще в разделе: (Показать все результаты (>6) - compmech.math.msu.su/ )

... Fast Facts about the Faculty of Journalism . ... Academic Departments . ... Partners . ... All partners . ... The department developed a general concept of professional training of journalists, which is the basis of the state standard in specialization Journalism , including both general theoretical disciplines and modern technology of journalism. ... Political Journalism?, ... 1999-2014 Faculty of Journalism, Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>29) - www.journ.msu.ru/ )

• International media readings :: Department of Journalism, M. V. Lomonosov

... H: · 1 ­ Al2O3­Na3AlF6 (T - x) = 1 , ­ , ­ 1 ( ­ ); · 1 ­ Na2SO4­H2O (T - x) = 1 ( ); · 25° ( .. ... Na2SO4­H2O Na2SO4 10H2O, Na2SO4 + 10H2O Na2SO4 10H2O. , , , . ... 6, 7) LiBr KBr, , : L LiBr() + KBr() . ... 1) , , KBr. ... L. PbTe­SnTe PbSe­SnSe PbTe PbSe, , (.. ... BeF2­LiF , ( ), LiBeF3 Li2BeF4 BeF2­LiF (. ... LiBeF3 280°, BeF2 Li2BeF4 : LiBeF3 () ­ Na2SO4 7H2O: Na2SO4 + 7H2O Na2SO4 7H2O. : Na2SO4 7H2O() Na2SO4 10H2O() Na2SO4 () Na2SO4 () +L 24° BeF2 () + Li2BeF4 () . ... Na2SO4­H2O Na2SO4­H2O....

Еще в разделе: (Показать все результаты (>35) - www.inorg.chem.msu.ru/ )

• http://www.inorg.chem.msu.ru/matsci/hydrothermal/pdf/2p-54.pdf
• Inorganic Chemistry Division

... In this article, the light propagation in a diffuser with optically soft inclusions is described with the help of the Fokker­Planck equation, i.e., a transfer equation with a diffusion term in the space of radiation-propagation directions. The coefficient of angle diffusion is calculated using the Mie theory. The equation is solved numerically using the stochastic analog method, and the space and angle distribution of the radiation that passed through the diffuser is calculated. ...

Еще в разделе: (Показать все результаты (>15) - lizard.phys.msu.su/ )

• http://lizard.phys.msu.su/home/science/Masyukov-Dmitriev-11-JMathSci-InN.pdf
• http://lizard.phys.msu.su/home/science/Masyukov-Dmitriev-11-JAP-InN.pdf
• http://lizard.phys.msu.su/home/science/jap-06.pdf

XIV " : " .. 24­26 2011 . 200 . This is a review of the 14th International conference "Russia and the West: the Dialogue of Cultures" organized by the Faculty of the Foreign Languages and Area Studies of the Moscow State Lomonosov University on November 24­26, 2011. ... Key words: conference, Moscow State Lomonosov University, area studies, history, philology and linguistics, cultural studies. ... XIV " : ". 300- .. . ...

Еще в разделе: (Показать все результаты (>55) - ffl.msu.ru/ )

• http://www.ffl.msu.ru/research/publications/komarova/komarova-the-earth-and-its-people.pdf
• http://www.ffl.msu.ru/faculty/departments/english-for-humanities/activities-of-the-department/abstracts-politologia.pdf
• http://www.ffl.msu.ru/faculty/departments/english-for-humanities/tezis.doc

... C*- algebras and elliptic theory - III: Schedule Monday, 26.01.2009 8:45-9:00 9: 00-9 :45 OPENING CEREMONY C*- algebras and Morse numbers of manifolds On some C*-algebraic tensor products Sharko, Vladimir Manuilov, 10: 00-10 :45 Vladimir 11:15-12:00 12:15-13:00 13:15-14:00 15: 00-15 :45 16: 00-16 :45 17:15-18:00 18:15-19:00 COFFEE BREAK Azzali, Sara Large time asymptotic for L^2 invariants for families Pavlov, Alexander Multipliers of $C^*$- Wednesday, 28.01.2009 EXCURSIONS DINNER . ...

Еще в разделе: (Показать все результаты (>131) - higeom.math.msu.su/ )

• C*-algebras and elliptic theory - III: Schedule
• C*-algebras: Talks

Geometry of X-ray sources in accreting black-hole binaries Andrzej A. Zdziarski N. Copernicus Astronomical Center, Warsaw The structure of the X-ray sources in the hard spectral state of accreting black-hole binaries has been a subject of intense debate. The paradigm dominant for many years postulated that the accretion disc in the hard state is truncated at some radius >> the innermost stable orbit (ISCO) whereas the disc reaches the ISCO in the soft state. ...

Еще в разделе: (Показать все результаты (>21) - master.sai.msu.ru/ )

• Ya.B. Zeldovich All-Moscow Seminar of Astrophysicists

Red Square at Night . The guide books were wrong when they told me that Moscow is dreary in November. ... The sound stands in contrast with the enormous bustle of Moscow. I teach in the Humanities building, a large rectangular steel and glass mirror just out of the shadow of the skyscraper that symbolizes Moscow State University. Getting in and out of the Humanities building means edging into a fast-moving stream of students and faculty who are hustling to class. ...

Еще в разделе: (Показать все результаты (>11) - suny.msu.ru/ )

... Д. л. кДлнйкЙмЦЗ еУТНУ,ТНЛИ ,,УТЫ ТЪ,ВММњИ ЫМЛ,В ТЛЪВЪ ЛП. е.З. гУПУМУТУ, унй нДдйЦ "тдДгД кДллнйьзав" ї кТЪУ ,,ЫВ, Д.л., 1999 , , - , . ... XX , кДлнйкЙмЦЗ Д.л. тдДгД кДллнйьзав Зй ЗлЦгЦззйв 91 , , , . ... 1 -0,4 3 0 0,4 (B-V)0 0,8 1,2 1,6 -2 5 0 7 V 9 2 Mv 4 11 6 M45 13 8 0 0,4 0,8 B-V 1,2 1,6 . ... кДлнйкЙмЦЗ Д.л. тдДгД кДллнйьзав Зй ЗлЦгЦззйв 93 1950 +24њ +22њ +20њ +18њ +16њ +14њ +12њ Ori Ori Ori +6њ 50 40 30 20 10 0 1950 Tau +10њ +8њ 20 10 0 6 h 5h 50 40 30 20 10 0 4h 50 40 +4њ 3h . ...

Еще в разделе: (Показать все результаты (>154) - www.pereplet.ru/ )

• Super Ratio

... Antal , T.K., Volgusheva , A.A., Kukarskih , G.P., Krendeleva , T.E., Rubin, A.B. Relationships between H 2 photoproduction and different electron transport pathways in sulfur-deprived Chlamydomonas reinhardtii (2009) International Journal of Hydrogen Energy, 34, pp. ... Antal , T.K., Volgusheva , A.A., Kukarskikh , G.P., Krendeleva , T.E., Tusov , V.B., Rubin, A.B. Examination of chlorophyll fluorescence in sulfur-deprived cells of Chlamydomonas reinhardtii (2006) Biofizika ., 51 (2), pp. ...

Еще в разделе: (Показать все результаты (>9) - biophys.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom_2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/jbcb_2006.pdf

... Department . ... Department of the Automation for Scientific Research (ASR) was founded in 1988 on the basis of research and teaching group of the Mathematical Physics Department (former Department of Computational Mathematics). ... Under his guidance the department performs wide spectrum of research in the field of computer simulation of complex systems and processes. ... https://cs.msu.ru/node/1707 . ... 2008?2016 ASR Department , CMC Faculty , Lomonosov MSU . ...

Еще в разделе: (Показать все результаты (>14) - ani.cmc.msu.ru/ )

pic] European Commission - Press release E7 billion boost for research and innovation will create jobs and growth Brussels, 19 July 2011 - Today Commissioner MАire Geoghegan-Quinn announced nearly E7 billion to kick-start innovation through research. ... Today, Europe is again showing its commitment to putting research and innovation at the top of the political agenda for growth and jobs. ... Research and innovation for cleaner, safer and more efficient transport and mobility will get E313 million. ...

Еще в разделе: (Показать все результаты (>28) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/CSA_guide_2008.pdf
• http://ideas.msu.ru/docs/Evaluation_panels.pdf

... О Школе . ... ВШБ МГУ - школе . ... Вестник. ... Главная Вестник. ... В естник М осковского университета . ... Key words: creativity, creativity factors, organization . ... В настоящее время в бизнесе разработан ряд новых организационных конфигураций. ... In view to the most rapid development, companies begin to use the adhocracy principles: create flexible horizontal structures, implement project management and encourage informal behavior and creativity. ... ЭКОНОМИКА И БИЗНЕС . ...

Еще в разделе: (Показать все результаты (>46) - www.mgubs.ru/ )

• Высшая школа бизнеса МГУ им. Ломоносова
• Выпуск 2/2011 | Высшая школа бизнеса МГУ им. Ломоносова
• Выпуск 1/2009 | Высшая школа бизнеса МГУ им. Ломоносова

... We will dwell on linguistic aspects and Lexical Resources of POLITEXT branch having in mind some intermediate semantic representation of a whole text as the basis for differentiated Information Extraction. It is personal data (in the social sphere) recognition in texts that we focus on, see (Leontyeva et al. ... As the main instrument of semantic analysis of coherent texts this dictionary bears the important information on how to build BTF-units starting from lexemes of SemDict entries. ...

Еще в разделе: (Показать все результаты (>4) - leontyeva.srcc.msu.ru/ )

... RELEC Mission: Relativistic ELECtron Precipitation and TLE Study on-board Small Spacecraft . ... Spacecraft mass: 283 kg. ... The Program of RELEC workshop July, 28, 29, Moscow more details.. ...

Еще в разделе: (Показать все результаты (>3) - vernov-relec.sinp.msu.ru/ )