. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>144) - monkey.belozersky.msu.ru/ )

• Inquiry information || Distances
• Inquiry information || Parsimony algorithm
• About COGs

. Laboratory Head: L.K.Gladilin, tel: (+7 495) 939 3568 , fax: (+7 495) 939 3064 , . Сотрудники Лаборатории (LHPR staff) . Web-pages: . L.K.Gladilin , . V.I.Rud , . I.A.Korzhavina , . Information for our Guests . Справка о создании и первом периоде работы лаборатории, подготовленная в 1980 г. Research Activities: . Scientific Information Search Engines : inSPIRE , ScienceResearch , Google Scholar . Scientific Servers : Interactions , AIP , Elements , Scientific . Feedback: Last modified on March 1, 2016.

Еще в разделе: (Показать все результаты (>9) - lhe.sinp.msu.ru/ )

... Graduate/PhD students as well as young specialists (including Post- Doc researchers) in the following areas: Material Science Semiconductors , RF, Electrical, and Electronic Engineering , Software Developing , Optical Engineering , and Fundamental Science are kindly welcome to participate in the Competition Application requirements: College/Graduate/PhD students, young specialists ... Science | ... Science |design, equipment design, chemical analysis, automation | ... Medal | ...

Еще в разделе: (Показать все результаты (>42) - www.msu.ru/ )

• http://www.msu.ru/science/details/2010/intel-rosnano-msu.doc
• http://www.msu.ru/science/details/2010/101021-moscow-how.pdf
• http://www.msu.ru/en/admissions/general-programs/docs/FACULTY%20OF%20GEOLOGY%20GEOCRYOLOGY.pdf

TITLE OF THE ABSTRACT FIRST I. AUTHOR1, SECOND I.J. AUTHOR2 AND THIRD AUTHOR2 1Organization name of the first author first_ author@email.ru 2Organization name of the second and third authors second.author@email.com, third_author@mail.eu Key words: list up to eight words or group of words in order of priority, separated by commas. ... The abstract including figures, tables and reference should not exceed 1 page. The title should be centered in the page, in 11pt, boldface Roman, all capital letters. ...

Еще в разделе: (Показать все результаты (>29) - hit-conf.imec.msu.ru/ )

... the north face outlet . ... ray ban outlet uk . ... 2016 С Днем Победы! ... win 7 ultimate product key Windows 8 key windows 7 key win 7 key windows 7 pro product key win 7 pro product key windows 7 activation key windows 7 ultimate product key windows 7 ultimate serial key windows 7 key online win 7 ultimate key win 7 serial keys Win 7 ultimate key Win 7 ultimate product key windows 7 key sale win 7 ultimate product Key Windows 7 key ultimate win 7 ultimate ...

Еще в разделе: (Показать все результаты (>88) - elana.sinp.msu.ru/ )

• cheap moncler jackets Eagle Broadband Picks Terremark NAPEagle says it selected
• cheap michael kors Herbal Antioxidants from the Journal of Orthomolecular
• north face outlet uk as well as increasing interest from companies throughout

ISSN 1560-3547, Regular and Chaotic Dynamics, 2015, Vol. ... The Dynamics of Systems with Servoconstraints. ... The presence of symmetries allows one to reduce the dynamic equations to a closed system of differential equations with quadratic right-hand sides on a Lie algebra. ... If v (x) = 0 for x = 0, then the system (3.1) admits an invariant straight line x = , where is a nonzero vector from Rp and the parameter changes with time according to the differential equation = c2 , c = 0. ... Theorem 2. ...

Еще в разделе: (Показать все результаты (>157) - ics.org.ru/ )

• http://ics.org.ru/upload/iblock/e97/2391-1.pdf
• http://ics.org.ru/upload/iblock/283/149-gauss-principle-and-realization-of-constraints_en.pdf
• http://ics.org.ru/upload/iblock/7bb/RCD701.pdf

... Basic Space Sciences in HighSchool and Cooperation in Space Education Pro jects 9 4 UNIVERSAT-2006 SCIENTIFIC PROGRAMME June 26, 2006, Monday 10:0013:00 Registration 13:0015:00 Lunch 15:0016:30 Opening Ceremony and Invited Reports INVITED REPORTS (30 min) 15:2015:50 Haubold, H.J., The United Nations Basic Space Science Initiative 15:5016:20 Krasotkin S.A., Panasyuk M.I., Radchenko V.V., Space research scientic and educational ... Chalova E.R., Aerospace images in school education 4. ...

Еще в разделе: (Показать все результаты (>44) - cosmos.msu.ru/ )

... 2 What is MATLAB ?? Basic Matrix Operations Script Files and M-files Some more Operations and Functions APPLICATIONS: Plotting functions .. ... Vectors are special forms of matrices and contain only one row OR one column. Scalars are matrices with only one row AND one column MATLAB Matrices 17 A matrix with only one row AND one column is a scalar. A scalar can be created in MATLAB as follows: ? a_value=23 a_value = 23 MATLAB Matrices 18 A matrix with only one row is called a row vector. ...

Еще в разделе: (Показать все результаты (>7) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.su/~yurin/Doxyfile
• http://imaging.cs.msu.ru/pub/2013.PRIA.Mamaev_Lukin_Yurin.HermiteNLM.en.pdf

... education . research . ... Fundamentals of Nanotechnology . ... Molecular physiology . ... Pass/fall exam: 5 p.m., 22 May, 2009 (those third-year students who pass the exam undertake further study majoring in Nanosystems and Nanodevices , Functional Nanomaterials , Nanobiomaterials and Nanobiotechnology). ... 10 February 2009 . ... Prof. Yu. ... Work of molecular motors: ATP synthetase, photosynthetic reaction centers, retinal containing photosensitive proteins (rhodopsin, bacteriorhodopsin.) ...

Еще в разделе: (Показать все результаты (>13) - nano.msu.ru/ )

• Fundamentals of Nanotechnology, 2009 | Научно-образовательный центр по
• Statute on the Methodical Commissions of the MSU Nanotechnology Education and

Discrete mechanics: a sequential growth dynamics for causal sets that is based on binary alternatives arXiv:1106.6269v1 [gr-qc] 11 May 2011 Alexey L. Krugly Abstract One of approaches to quantum gravity is different mo dels of a discrete pregeometry. ... These primitive pro cesses are called monads [11]. ... Two new maximal monads and one new minimal monad appear. ... The probability of elementary extension to the future depends only on the past sets of maximal monads that take part in this extension. ...

Еще в разделе: (Показать все результаты (>21) - temporology.bio.msu.ru/ )

• http://temporology.bio.msu.ru/EREPORTS/krugly_the-dinamics.pdf
• http://temporology.bio.msu.ru/EREPORTS/krugly_unfaithful.pdf
• http://temporology.bio.msu.ru/EREPORTS/krugly_discrete.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/batmas30.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom2_2013.pdf

... Seasonal changes in microsomal fraction enriched with Na,K-ATPase from kidneys of the ground squirrel Spermophilus undulatus. ... The Na,K-ATPase activity in microsomal fraction isolated from kidneys of winter hibernating ground squirrels was found to be 1.8-2.0-fold lower than that in active animals in summer. ... We suggest that the decrease in Na,K-ATPase activity in kidneys of ground squirrels during hibernation is mainly connected with the aggregation of proteins in plasma membrane. ...

Еще в разделе: (Показать все результаты (>41) - biochem.bio.msu.ru/ )

• Upstream open reading frames regulate translation of the long isoform of SLAMF1
• Low Concentrations of Hydrogen Peroxide Activate the Antioxidant Defense System

... Interaction classes . ... List of Contact Types: . ... Contact with Major Groove of DNA by helices, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by strands, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by helices, loops . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by loops . ...

Еще в разделе: (Показать все результаты (>4) - npidb.belozersky.msu.ru/ )

• NPIDB: Home

... Ярмарка вакансий и стажировок для студентов и выпускников вузов . Новости науки и техники События . ... Подписаться на новости . ... Computer Science . ... Software engineering for mobile devices . ... Design and development of middleware (collaboration system, context-aware system, content system) on mobile devices . Design and development of applications on mobile devices . ... 2) Embedded OS porting, system programming, Mobile OS . ... 5) Location-based service on mobile devices . ...

Еще в разделе: (Показать все результаты (>34) - www.physcareer.ru/ )

• Software Engineer (Server) / Вакансии / Physcareer.ru
• Software Engineer (Backend Servers / Web / WAP / Вакансии / Physcareer.ru
• Software Engineer (C/C++ and JAVA) / Вакансии / Physcareer.ru

ISSN 0026-2617, Microbiology, 2008, Vol. ... Key words: late stationary phase, secondary growth, Pseudomonas aeruginosa, S and M dissociants, population structure of the culture. ... Growth dynamics and population composition of a mixed culture of P. aeruginosa S and M dissociants in the variant of autolysis in the late stationary phase: optical density, OD з 100 (1); ratio of the M dissociant in the population, % (2); pH (3); and content of reducing sugars, mg % (as glucose) (4). ...

Еще в разделе: (Показать все результаты (>15) - dis.bio.msu.ru/ )

• Именной указатель

Franco Peracchi IV and GMM under weak instruments Spring 2011 Course outline 1. The instrumental variables (IV) method Ї Ї Ї Ї Ї Ї Ї Ї Ї Ї Ї Ї Ї Ї Ї Ї Ї Ї Ї Ї Ї Ї Ї Ї Ї Ї Ї Ї Inconsistency of OLS The simple IV estimator The class of IV estimators Sampling properties Estimates of statistical precision Hypothesis testing 2SLS Motivating examples Definitions and basic models The bias of 2SLS Standard asymptotic approximations Alternative asymptotic approximations Detecting weak ...

Еще в разделе: (Показать все результаты (>19) - www.mse-msu.ru/ )

• http://www.mse-msu.ru/Ayvazyan_Introduction_to_the_textbook_on_econometrics.pdf

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>17) - tukachev.flogiston.ru/ )

• Category: Новости

... Fast Facts about the Faculty of Journalism . ... Academic Departments . ... Partners . ... All partners . ... The Department of Television and Radio Broadcasting was established in 1958. The department was the first in the USSR and in Russia, where the theoretical foundations of television and radio broadcasting were studied and taught.  ... Textbooks and monographs written by professors and lecturers of the department are widely used in Journalism Schools both in Russia and abroad. ...

Еще в разделе: (Показать все результаты (>61) - www.journ.msu.ru/ )

• A public talk of Professor Nico Carpentier :: Department of Journalism, M. V.
• International Media Management Academic Association's (IMMAA) Annual
• International Media Management Academic Association's (IMMAA) Annual Conference

IV чемпионат проекта 'Воздушно-инженерная школа (Cansat в России)'. Дубна и Талдомский р-н, 01.07.20 . С 29 июня по 4 июля 2015 года в г.Дубна (филиал НИИЯФ МГУ) и Талдомском районе Московской области будет проходить 4-й ежегодный чемпионат проекта 'СanSat в России'. ... Ссылка на предыдущие соревнования: http://www.msu.dubna.ru/main/index.php?option=com_content&task=view&id=77&Itemid=1 . ... Открытие в филиале НИИЯФ МГУ (Дубна, ул. Ленинградская д. 12), публичные . ...

Еще в разделе: (Показать все результаты (>15) - www.msu.dubna.ru/ )

• MSU @ Dubna - Conference on 'Reflections on the atomic nucleus', 28.06.2015,

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . PhD, scientist Marina E. Tamm . ... Broad-scoped inorganic chemist. ... Seminars and practical work on inorganic chemistry for first-year students . ... Neudachina V.S., Shatalova T.B., Shtanov V.I., Yashina L.V., Zyubina T.S., Tamm M.E., Kobeleva S.P. Surface Science 2005, v. 584, iss. 1, p. 77-82. ... 2008-2010 The Laboratory of chemistry and physics of sensor and semiconductor materials. ...

Еще в разделе: (Показать все результаты (>23) - www.lssm.inorg.chem.msu.ru/ )

• Лаборатория химии и физики полупроводниковых и сенсорных материалов | Проекты
• The Laboratory of chemistry and physics of sensor and semiconductor materials
• The Laboratory of chemistry and physics of sensor and