... Carbamide . ... Moscowљ? ... URALCHEM and Stamicarbon will develop a new technology for urea production . URALCHEM, a leading Russian producer of nitrogen fertilizers, signed a joint technology development agreement for the synthesis of urea with Stamicarbon, the world's top developer and licensor of urea processes. ... Laboratory of Chemical Thermodynamics љwasљestablished by Prof. Adam V. Rakovsky (corresponding member of USSR Academy of Sciences) first as a "halurgy laboratory" in 1930. ...

Еще в разделе: (Показать все результаты (>7) - td.chem.msu.ru/ )

Electronic Proposal Submission Service - EPSS preparation and submission guide - Release Date: 5 May 2008 Table of Contents 1 1 .1 . ... Using PIC in EPSS.. ... 29 EPSS help desk Phone: +32 2 23 33 760 Email: support@epss-fp7.org EPSS User Manual Released on 5 May 2008 page 2 of 29 1 EPSS Preparation ­User's Guide The EPSS (Electronic Proposal Submission Service) allows Proposers to create their proposal completely on-line without downloading or saving anything on their local personal computer. ...

Еще в разделе: (Показать все результаты (>32) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/ERC_rules.pdf
• http://ideas.msu.ru/docs/CSA_guide_2008.pdf
• http://ideas.msu.ru/docs/ERC_guide_preparation.pdf

... Many of these planetesimals had metallic iron cores and during growth of the Earth this metal re-equilibrated with the Earth's silicate mantle, extracting siderophile (`iron-loving') elements into the Earth's iron-rich core. ... Chemical signature of core formation Growth of the Earth from planetary embryos and planetesimals resulted in the substantial partitioning of siderophile elements into the metallic core, leaving lithophile elements behind in the silicate mantle. ... REE, rare-earth elements....

Еще в разделе: (Показать все результаты (>15) - ocean.phys.msu.ru/ )

• Index of /courses/stathyd/book by Nosov/
• Index of /courses/watercoursedyn/

... Basic Space Sciences in HighSchool and Cooperation in Space Education Pro jects 9 4 UNIVERSAT-2006 SCIENTIFIC PROGRAMME June 26, 2006, Monday 10:0013:00 Registration 13:0015:00 Lunch 15:0016:30 Opening Ceremony and Invited Reports INVITED REPORTS (30 min) 15:2015:50 Haubold, H.J., The United Nations Basic Space Science Initiative 15:5016:20 Krasotkin S.A., Panasyuk M.I., Radchenko V.V., Space research scientic and educational ... Chalova E.R., Aerospace images in school education 4. ...

Еще в разделе: (Показать все результаты (>50) - cosmos.msu.ru/ )

• University Satellites and Space Science Education '2006

... Ярмарка вакансий и стажировок для студентов и выпускников вузов . Новости науки и техники События . ... Подписаться на новости . ... Computer Science . ... Software engineering for mobile devices . ... Design and development of middleware (collaboration system, context-aware system, content system) on mobile devices . Design and development of applications on mobile devices . ... 2) Embedded OS porting, system programming, Mobile OS . ... 5) Location-based service on mobile devices . ...

Еще в разделе: (Показать все результаты (>80) - www.physcareer.ru/ )

• Software Engineer (Server) / Вакансии / Physcareer.ru
• Научная стажировка и постоянная работа в подразделении Telecommunication
• Software Engineer (Backend Servers / Web / WAP / Вакансии / Physcareer.ru

... 4; mso-font-charset:204; mso-generic-font-family:swiss; mso-font-pitch:variable; mso-font-signature:536871559 0 0 0 415 0;} /* Style Definitions */ p.MsoNormal, li.MsoNormal, div.MsoNormal {mso- style -parent: ; margin:0cm; margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:12.0pt; font-family: Times New ...

Еще в разделе: (Показать все результаты (>69) - sai.msu.ru/ )

• http://www.sai.msu.ru/internal/library/ieee_tutorial.doc
• International School "Frontiers in Numerical Gravitational Astrophysics"
• European Astronomical Society(EAS): NEWS

... Scientific Effort . ... Cosmic ray astrophysics . Space Physics . ... Nuclear physics . ... The paper was prepared with contributions from Elena Popova from the Skobeltsyn Institute of Nuclear Physics (Lomonosov Moscow State University) and was published in Scientific Reports. ... Federal State Budget Educational Institution of Higher Education M.V.Lomonosov Moscow State University, Skobeltsyn Institute of Nuclear Physics (SINP MSU), 1(2), Leninskie gory, GSP-1, Moscow 119991, Russian Federation . ...

Еще в разделе: (Показать все результаты (>3) - sinp.msu.ru/ )

Oceanology, Vol. ... MARINE BIOLOGY A Comparative Study of the Primary Production in the Norwegian Sea by Different Methods V. V. Sapozhnikov*, V. B. Goryunova*, B. A. Levenko**, L. E. Dulova***, T. K. Antal**, and D. N. Matorin** * All-Russia Research ... Microbiology, Russian Academy of Sciences, Moscow, Russia Received December 1, 1998; in final form, March 1, 1999 Abstract--The results of primary production measurements obtained by different methods are presented ... OCEANOLOGY Vol. ...

Еще в разделе: (Показать все результаты (>36) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/matorin/3404.pdf
• http://library.biophys.msu.ru/matorin/3385.pdf
• http://library.biophys.msu.ru/PDF/3345.pdf

... О физическом факультете . ... Помощь факультету . ССО факультета . ... Система электронного документооборота (СЭД) МГУ . ... Физический факультет . ... Наш факультет . Новости факультета . История факультета . Подразделения факультета . Выпускники факультета . ... Журнал "Ученые записки физич. факультета МГУ" . ... Научные семинары . ... Журнал "Ученые записки физического факультета МГУ" . ... Тема: 'Modeling and Control of Physiological Process: Towards Systems Medicine'. ...

Еще в разделе: (Показать все результаты (>129) - phys.msu.ru/ )

• "EURASIP Journal on Applied Signal Processing
• Title
• Гумбольдтовская лекция на физфаке

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom2_2013.pdf

... 2.9 Using a pre-computed guide tree . ... 3 File Formats . ... With challenging sets of sequences, it is a good idea to make several different alignments using different muscle options and to try other programs too. ... You can ask muscle to try to improve an existing alignment by using the – refine option. ... If you have two existing alignments of related sequences you can use the –profile option of MUSCLE to align those two sequences. ... MUSCLE uses FASTA format for both input and output. ...

Еще в разделе: (Показать все результаты (>186) - www.genebee.msu.ru/ )

• GeneBee BLAST 2.2.8 Services Help
• GeneBee BLAST 2.2.22+ Services Help
• DIMACS Series in Discrete Mathematics

Sergey A. Ayvazyan Methods of Econometrics Introduction Dear reader, You have a textbook in your hands on methods of econometrics, one of the three basic disciplines of higher economic learning, along with micro- and macroeconomics. In Russia, unfortunately, the status of econometrics was recognized belatedly: econometrics was introduced into the study programs of economic learning in several leading Russian higher educational institutions only since 1992. ...

Еще в разделе: (Показать все результаты (>18) - www.mse-msu.ru/ )

Vladimir Feldman (Moscow U) Q: How can we purify water using solvated electron? ... However, they cannot help, when we deal with some very important toxic contaminations, which are not readily oxidized (heavy metal ions, chlorinated compounds, etc.) ... The examples of these reactions were given shown in lecture. ... Indeed, irradiation of water with fast electrons produces both strong oxidizer (OH radical) and very efficient reducing species (hydrated electron) in nearly balanced amounts. ...

Еще в разделе: (Показать все результаты (>19) - www.elch.chem.msu.ru/ )

... Statutes of ERC . Methodical Commissions of ERC . ... The Methodical Commissions of the MSU Nanotechnology Education and Research Center (ERC) are set up according to all the research specializations of ERC. The Methodical Commissions of ERC are collegial bodies that prepare education programs of ERC and programs for developing courseware and training materials. ... ERC participants may be mutually agreed with members of methodical commissions representing relevant faculties and chairs. ...

Еще в разделе: (Показать все результаты (>14) - nano.msu.ru/ )

. Print . Details . Written by Ольга Жулябина . Published: 29 November 2015 . Sorry, this page has no english version.

Еще в разделе: (Показать все результаты (>71) - engineering.phys.msu.ru/ )

• Introduction to Linux
• Circuit Diagnostics
• Branches

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>86) - monkey.belozersky.msu.ru/ )

• SDPpred
• About COGs
• Hydrophobic clusters

... Scientific goals . Cosmic rays of extremely high energy . ... Gamma-bursts . Magnetospheric particles and radiation conditions . ... The Earth?s atmosphere is ?a target? for different types of space radiation. ... In the atmosphere high energy particles produce cascades of the secondary particles ? ... Gamma-bursts also produce their ?response? in the atmosphere in the form of Сherenkov radiation. ... Studies of the described above phenomena is the main goal of the ?Lomonosov? satellite. ...

Еще в разделе: (Показать все результаты (>26) - lomonosov.sinp.msu.ru/ )

... Юрий (admin) Новости архивы , психометрика , электронные журналы No Comments . ... Ноя 27 . ... Юрий (admin) Новости профессии , профориентация No Comments . ... Юрий (admin) Новости инфограмма , профессии , профориентация No Comments . ... Юрий (admin) Новости день психолога , о профессиях No Comments . ... Юрий (admin) Новости видео , научные конференции , экспериментальная психология , эксперименты No Comments . ... Юрий (admin) Новости заработок в интернете , платные опросы No Comments . ...

Еще в разделе: (Показать все результаты (>14) - tukachev.flogiston.ru/ )

• Statistics One, Lecture 3, example script

IV чемпионат проекта 'Воздушно-инженерная школа (Cansat в России)'. Дубна и Талдомский р-н, 01.07.20 . С 29 июня по 4 июля 2015 года в г.Дубна (филиал НИИЯФ МГУ) и Талдомском районе Московской области будет проходить 4-й ежегодный чемпионат проекта 'СanSat в России'. ... Ссылка на предыдущие соревнования: http://www.msu.dubna.ru/main/index.php?option=com_content&task=view&id=77&Itemid=1 . ... Открытие в филиале НИИЯФ МГУ (Дубна, ул. Ленинградская д. 12), публичные . ...

Еще в разделе: (Показать все результаты (>12) - www.msu.dubna.ru/ )

... International Relations in Context of Global Processes - 17| ... GLOBAL ECONOMIC AND POLITICAL TRENDS Prof. Olga Y. Kornienko Economic literature survey Week 1 (4 academic hours ) 1) Current trends of global economy Week 2 (4 academic hours ) 2) Migration, population and globalization Week 3 (4 academic hours ) 3) Corporate culture and management: new trends Week 4 (4 academic hours ) 4) Development markets in global environment Week 5 (4 academic ... Models of the global world. ...

Еще в разделе: (Показать все результаты (>116) - fgp.msu.ru/ )

• http://fgp.msu.ru/wp-content/uploads/2014/09/UNESCO_CHAIR-1.pdf
• http://fgp.msu.ru/wp-content/uploads/2014/09/UNESCO_CHAIR-2.pdf