... Т.А. Власова. ... T.A. Vlassova. ... Acta horticularae, 1994, 381, (Proc. of International Symposium on Natural Phenols in Plant Resistance, 13-17 Sept. ... In: Modern fungicides and antifungal compounds 11, Intercept LTD, Andover, U.K.,( Proc of 12th International Symposium, Castle of Reinhardsbrunn, Germany, May 24-29, 1998), P.242-245. ... In: Modern fungicides and antifungal compounds (14th International Symposium, Castle of Reinhardsbrunn/Friedrichroda, Germany, April 25-29, 2004, Abstracts). ...

Еще в разделе: (Показать все результаты (>4) - plantphys.bio.msu.ru/ )

... Ярмарка вакансий и стажировок для студентов и выпускников вузов . Новости науки и техники События . ... Подписаться на новости . ... Computer Science . ... Software engineering for mobile devices . ... Design and development of middleware (collaboration system, context-aware system, content system) on mobile devices . Design and development of applications on mobile devices . ... 2) Embedded OS porting, system programming, Mobile OS . ... 5) Location-based service on mobile devices . ...

Еще в разделе: (Показать все результаты (>14) - www.physcareer.ru/ )

• Software Engineer (Server) / Вакансии / Physcareer.ru
• Software Engineer (Backend Servers / Web / WAP / Вакансии / Physcareer.ru
• Software Engineer (C/C++ and JAVA) / Вакансии / Physcareer.ru

... The results of the study of thermal properties of MAPCB crystals in the temperature interval 90-330 K are presented. Specific heat anomalies at the second order phase transition at 160 K and 307 K are revealed and discussed. ... The existence of different types of the crystal change without symmetry alteration (the first order phase transition, critical point, overcritical behaviour) was predicted and shown to relate closely to liquid-gas transformation behaviour. ...

Еще в разделе: (Показать все результаты (>48) - scon155.phys.msu.su/ )

• Proceedings of the Fifth Russian-Japanese Symposium on Ferroelectricity

... The BLAST programs were tailored for sequence similarity searching for example to identify homologs to a query sequence. ... This program uses a "greedy algorithm" ( Webb Miller et al. ) for nucleotide sequence alignment searches and concatenates many queries to save time spent scanning the database. ... In the programmatic implementations of the BLAST algorithm described here, each HSP consists of a segment from the query sequence and one from a database sequence. ...

Еще в разделе: (Показать все результаты (>154) - www.genebee.msu.ru/ )

• GeneBee BLAST 2.2.8 Services Help
• BLAST Reference Manual Pages
• Selected Scientific Journals - Search Engines

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

... Statutes of ERC . Methodical Commissions of ERC . ... The Methodical Commissions of the MSU Nanotechnology Education and Research Center (ERC) are set up according to all the research specializations of ERC. The Methodical Commissions of ERC are collegial bodies that prepare education programs of ERC and programs for developing courseware and training materials. ... ERC participants may be mutually agreed with members of methodical commissions representing relevant faculties and chairs. ...

Еще в разделе: (Показать все результаты (>10) - nano.msu.ru/ )

• MSU Nanotechnology Education and Research Center. Mission. | MSU Nanotechnology

. The work is supported by the Russian Foundation for Basic Research, grant 10-07-00685-a . PDB . Classification . Domain instances . Bonded with NA . total (0 entries) . 0 . 0 . No comments on this family . Send your questions and comments to sas@belozersky.msu.ru .

Еще в разделе: (Показать все результаты (>852) - monkey.belozersky.msu.ru/ )

• SDP home page
• PDB entries containing domains of the family "D12 class N6 adenine-specific DNA
• PDB entries containing domains of the family "C-5 cytosine-specific DNA

... The study of adaptive variability, i.e. the study on the population level of the physiological adaptation of the human organism to a variety of environmental conditions, is the main purpose and the basic principle of physiological anthropology. ... Regional rates of hormonal activity of indigenous population of different ethno-territorial groups that we have elaborated broaden our notions about common conformities of age variability and aging and the reasons of these processes. ...

Еще в разделе: (Показать все результаты (>26) - www.anthropos.msu.ru/ )

• http://www.antropos.msu.ru/vestnic/e2015_3.doc
• http://www.antropos.msu.ru/vestnic/e2014_4.doc
• http://www.antropos.msu.ru/vestnic/e2013_2.doc

... Cultural Mediation of National History and Identity . ... Second International Conference in Tampere , Finland . ... This sense of national identity, of history and possible futures, is communicated by cultural and institutional forces and integrated, individually and collectively, into our sense of a common shared nationhood. ... Through a semiological analysis of television texts, it is demonstrated how, by a re-interpretation of Russian history, new cultural and national identities are...

Еще в разделе: (Показать все результаты (>4) - psyberlink.flogiston.ru/ )

... proposals* are presented by multinational consortia of organisations/individuals Proposals are evaluated by independent experts All proposal coordinators receive an Evaluation Summary Report Funding follows successful evaluation, selection and negotiation of grant agreement * except certain Support actions ··· 2 Who can participate · Three independent legal entities from three different EU Member States or Associated countries (presently ... 19 Proposals and projects in FP7 3. ...

Еще в разделе: (Показать все результаты (>42) - www.msu.ru/ )

• http://www.msu.ru/science/details/2010/intel-rosnano-msu.doc
• http://www.msu.ru/science/details/2010/101021-moscow-wp2011.pdf
• http://www.msu.ru/science/details/2010/101021-moscow-eu-ru-call.pdf

... Seasonal changes in microsomal fraction enriched with Na,K-ATPase from kidneys of the ground squirrel Spermophilus undulatus. ... The Na,K-ATPase activity in microsomal fraction isolated from kidneys of winter hibernating ground squirrels was found to be 1.8-2.0-fold lower than that in active animals in summer. ... We suggest that the decrease in Na,K-ATPase activity in kidneys of ground squirrels during hibernation is mainly connected with the aggregation of proteins in plasma membrane. ...

Еще в разделе: (Показать все результаты (>56) - biochem.bio.msu.ru/ )

• Clinical differences between total PAPP-A and measurements specific for the
• Sperm-specific glyceraldehyde-3-phosphate dehydrogenase is stabilized by
• Generation of recombinant antibodies and means for increasing their affinity.

The 4th All-Russia conference "Radar-Location and Radio Communication" Dear colleagues! ... Information for authors and participants of conference is in Journal of Radio Electronics (JRE) http://jre.cplire.ru/jre/contents.html in th e section http://jre.cplire.ru/jre/4conf/index.htm. ... IV « » 29 - 3 .. « » http://jre.cplire.ru/jre/contents.html http://jre.cplire.ru/jre/4conf/index.ht m . http://jre.cplire.ru/jre/4conf/ members.htm Email: falcon@cplire.ru , rudolf@cplire.ru org4conf@cplire.ru . ...

Еще в разделе: (Показать все результаты (>79) - phys.msu.ru/ )

• http://phys.msu.su/upload/iblock/5ef/4conference.pdf
• http://phys.msu.su/upload/iblock/a95/1stcall.doc

... Юрий (admin) Новости архивы , психометрика , электронные журналы No Comments . ... Ноя 27 . ... Юрий (admin) Новости профессии , профориентация No Comments . ... Юрий (admin) Новости инфограмма , профессии , профориентация No Comments . ... Юрий (admin) Новости день психолога , о профессиях No Comments . ... Юрий (admin) Новости видео , научные конференции , экспериментальная психология , эксперименты No Comments . ... Юрий (admin) Новости заработок в интернете , платные опросы No Comments . ...

Еще в разделе: (Показать все результаты (>14) - tukachev.flogiston.ru/ )

• Statistics One, Lecture 3, example script

... Fast Facts about the Faculty of Journalism . ... Academic Departments . ... Partners . ... All partners . ... The Department of Television and Radio Broadcasting was established in 1958. The department was the first in the USSR and in Russia, where the theoretical foundations of television and radio broadcasting were studied and taught.љ ... Textbooks and monographs written by professors and lecturers of the department are widely used in Journalism Schools both in Russia and abroad. ...

Еще в разделе: (Показать все результаты (>45) - www.journ.msu.ru/ )

• A public talk of Professor Nico Carpentier :: Department of Journalism, M. V.
• International Media Management Academic Association's (IMMAA) Annual
• International Media Management Academic Association's (IMMAA) Annual Conference

IV чемпионат проекта 'Воздушно-инженерная школа (Cansat в России)'. Дубна и Талдомский р-н, 01.07.20 . С 29 июня по 4 июля 2015 года в г.Дубна (филиал НИИЯФ МГУ) и Талдомском районе Московской области будет проходить 4-й ежегодный чемпионат проекта 'СanSat в России'. ... Ссылка на предыдущие соревнования: http://www.msu.dubna.ru/main/index.php?option=com_content&task=view&id=77&Itemid=1 . ... Открытие в филиале НИИЯФ МГУ (Дубна, ул. Ленинградская д. 12), публичные . ...

Еще в разделе: (Показать все результаты (>12) - www.msu.dubna.ru/ )

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>14) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt