... 100 KeV, Protons 0.8-1 MeV (horizontal) . 300 KeV (horizontal) . Protons 8-65 MeV (horizontal) . ... Satellite flyby in chosen time period (dynamic picture) . ... Select a spacecraft Meteor 1 Meteor 2 Relec Electro . ... Retrieve trajectory . ...

Еще в разделе: (Показать все результаты (>3) - dec1.sinp.msu.ru/ )

THE JOURNAL OF CHEMICAL PHYSICS 133, 144101 2010 Effective numbers of modes applied to analysis of internal dynamics of weakly bound clusters A. A. Rybakov,a E. D. Belega, and D. N. Trubnikov Department of ... Russia Received 11 June 2009; accepted 14 September 2010; published online 11 October 2010 The dependence of the volume of the chaotic component in the internal dynamics of triatomic van der Waals clusters on the angular ... When such difference is small, the regular motion disappears. ...

Еще в разделе: (Показать все результаты (>18) - beams.chem.msu.ru/ )

• http://beams.chem.msu.ru/sotrudniki/larin/PCCP2.pdf
• http://beams.chem.msu.ru/doc/JAP2004_96_109.pdf
• http://beams.chem.msu.ru/doc/JMC168.pdf

... Company Presentation, Workshops & Evening Reception Wednesday 30th September 2009, 14:30 - 19:30 Sheraton Palace Hotel Moscow, Rooms St.Petersburg 1-2 The presentation will give you an insight in our business model, our culture. Workshops will provide you with information on how to apply for full-time positions and internships. ... To register for the event, please apply online at www.barcap.com/expectexcellence and select "Moscow" as the location in your application. ...

Еще в разделе: (Показать все результаты (>49) - www.msu.ru/ )

• General Information

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/insilicobiol_2003.pdf

... 3D magnetosphere . ... Data . ... Magnetosphere . ... Magnetic field at the selected point Module of the Magnetic field distribution along Sun-Earth line Noon-Midnight magnetosphere structure . ... Point coordinates, where magnetic field will be calculated: . ... Magnetic field at MD outer edge . ... Magnetic field at TC inner edge . ... Distance to external edge of MD . ... Distance to inner edge of MD . ... Magnetopause stand-off distance . ... Distance to inner edge of geotail current sheet . ...

Еще в разделе: (Показать все результаты (>9) - swx.sinp.msu.ru/ )

• SWX - Главная

Unfaithful embedding of causal sets arXiv:1006.2320v1 [physics.gen-ph] 10 Jun 2010 Alexey L. Krugly Abstract In the causal set approach, spacetime is a continuous approximation of a faithful emb edded causal set. But the faithful emb edded causal set describ es the empty spacetime and cannot describ e matter. ... If we describe the elements of the faithfully embedded causal set as the vertices of the graph, and segments of the timelike curves as edges these vertices must have an infinite valency. ...

Еще в разделе: (Показать все результаты (>19) - temporology.bio.msu.ru/ )

• http://temporology.bio.msu.ru/EREPORTS/krugly_an-example.pdf
• Уравнения динамики систем

... Scientific goals . Cosmic rays of extremely high energy . ... Gamma-bursts . Magnetospheric particles and radiation conditions . ... The Earth?s atmosphere is ?a target? for different types of space radiation. ... In the atmosphere high energy particles produce cascades of the secondary particles ? ... Gamma-bursts also produce their ?response? in the atmosphere in the form of Сherenkov radiation. ... Studies of the described above phenomena is the main goal of the ?Lomonosov? satellite. ...

Еще в разделе: (Показать все результаты (>22) - lomonosov.sinp.msu.ru/ )

• Mikhail Lomonosov ? the Pioneer of Russian Science | Университетский спутник

... info@ecfs.msu.ru . ... Topic 2: Barriers to Sustainable Soil.. ... We are inviting you to participate in our consultation on "Barriers to Sustainable Soil Management in Eurasia and possible ways for overcoming them".љ ... Is workforce capacity in the Eurasian region sufficient for adopting sustainable soil management practices? ... Мы приглашаем вас принять участие в нашей консультации "Барьеры на пути к устойчивому землепользованию в Евразии и возможные пути их преодоления".љ ... Topic 2 . ...

Еще в разделе: (Показать все результаты (>11) - ecfs.msu.ru/ )

• Topic 1: Building the Eurasian Food Security Network / Создание Евразийской

... IV, part 1 ACTA TRANSACTIONS Edited by N. N. Kazansky St. Petersburg Nauka 2008 RUSSIAN ACADEMY OF SCIENCES INSTITUTE FOR LINGUISTIC STUDIES CLASSICA ET INDOGERMANICA COLLOQUIA IV STUDIES IN CLASSICAL PHILOLOGY AND INDO-EUROPEAN LANGUAGES Edited by N. N. Kazansky Saint Petersburg Nauka 2008 Ilya Yakubovich HITTITE-LUVIAN BILINGUALISM AND THE DEVELOPMENT OF ANATOLIAN HIEROGLYPHS 1. ... The development of the Anatolian hieroglyphic script represented a long process. ... 18 Hittite-Luvian Bilingualism...

Еще в разделе: (Показать все результаты (>18) - imk.msu.ru/ )

• http://www.imk.msu.ru/Structure/Linguistics/yakubovich/download/sippanti.pdf
• http://www.imk.msu.ru/Structure/Linguistics/yakubovich/download/refl-ucla.pdf
• http://www.imk.msu.ru/Structure/Linguistics/yakubovich/download/luwian.pdf

Dynamo Theory and Earth's Magnetic Field Paul Demorest May 21, 2001 1 Intro duction The Earth's magnetic field belongs in that class of physical phenomena which are commonplace yet also very complex. ... 3 Single Disc Dynamo Before we dive into the mess of equations and approximations that describe how fluid motion and magnetic field interact, it is useful to demonstrate a very simple system which exhibits dynamo action. ... A system without fluid motion cannot support a magnetic field indefinitely. ...

Еще в разделе: (Показать все результаты (>14) - ocean.phys.msu.ru/ )

• http://ocean.phys.msu.ru/courses/stathyd/2001%20Ferrari%20et%20al.%2C%20The%20temperature-salinity%20relationship%20of%20the%20mixed%20layer.pdf
• http://ocean.phys.msu.ru/courses/stathyd/2005%20Smyth%20et%20al.%2C%20Differential%20diffusion%20in%20breaking%20Kelvin-Helmholtz%20billows.pdf
• http://ocean.phys.msu.ru/courses/geo/lectures-addons/02/2009%20Bromm%20et%20al.%2C%20The%20formation%20of%20the%20first%20stars%20and%20galaxies.pdf

... 000, 1­13 (2010) Printed 21 September 2011 A (MN L TEX style file v2.2) A universal ultraviolet-optical colour­colour­magnitude relation of galaxies I1gor V. Chilingarian1,2, and Ivan Yu. ... Received 2011 Sep 15; in original form 2011 Feb 6 ABSTRACT The bimodal galaxy distribution in the optical colour­magnitude diagram (CMD) comprises a narrow "red sequence" populated mostly by early-type galaxies and a broad "blue cloud" dominated by star-forming systems. ...

Еще в разделе: (Показать все результаты (>10) - kcor.sai.msu.ru/ )

• K-corrections calculator
• K-corrections calculator (version 2010)

Russian TeX Disk . ... Please, use "Save link as" (right mouse button) for downloading files, otherwise binary files will be corrupted. What is russian TeX disk . ... Some TeX versions and tools are installed/russified and can be started directly from CD; other are only distributives plus additional files for their russification. ... FPTEX . ... Directory russian.add: Generic files (mf-sources, pfb-fonts and hyphen file) for russification of any-TeX-realizations in: . ... file readme: . ...

Еще в разделе: (Показать все результаты (>6) - tex.bog.msu.ru/ )

• http://tex.bog.msu.ru/

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>13) - tukachev.flogiston.ru/ )

• Category: Новости

E. A. KUDRYAVTSEVA FacultyofMechanics and Mathematics Department of Di erential Geometry and Applications Moscow State University Vorob'ievy gory, 119899 Moscow, Russia E-mail: ekudr@beta.math.msu.su REDUCTION OF MORSE FUNCTIONS ON SURFACES TO CANONICAL FORM BY SMOOTH DEFORMATION Received September 12, 1999 , Relatively recently in works 3, 4 the topological classi cation of smooth Hamiltonian systems with one degree of freedom was obtained. ... The Reeb graph of a function is de ned as follows. ...

Еще в разделе: (Показать все результаты (>44) - dfgm.math.msu.su/ )

• http://dfgm.math.msu.su/files/0articles/Ilyutko/0904.2862v1.pdf
• http://dfgm.math.msu.su/files/0articles/Ilyutko/ilyutko-JKTR.pdf
• http://dfgm.math.msu.su/files/papers-sym/reg%20maps%20nonorientable%20surfaces.pdf

... B Dispatch: 30.1.04 Author Received: Journal: JEB CE: Kumar No. of pages: 12 PE: Sri doi:10.1111/j.1420-9101.2004.00705.x Human birthweight evolution across contrasting environments F. T H OMAS , * A . ... The model illustrates that optimal birthweight depends on which fitness-reducing risk locally predominates (somatic diseases, parasitic diseases or adverse environmental conditions). ... Growth in utero, blood pressure in childhood and adult life, and mortality from cardiovascular disease. ...

Еще в разделе: (Показать все результаты (>32) - ecology.genebee.msu.ru/ )

• http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/2008_R0r_EcolMod.pdf
• http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/2000_Longev_JEvolBio.pdf
• http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/2002_Host_manip_IJP.pdf

... The Informativeness of Coherence Analysis in EEG Studies A. P. Kulaichev UDC 612.821.6 Translated from Zhurnal Vysshei Nervnoi Deyatel'nosti imeni I. P. Pavlova, Vol. ... KEY WORDS: coherence, spectral analysis, EEG non-stationarity, amplitude modulation. ... In particular, the two fundamental differences between EEG signals and most other physical signals are not considered: a) fundamental non-stationarity; b) amplitude modulation at all frequency ranges. ... Coherence in technical addenda. ...

Еще в разделе: (Показать все результаты (>11) - www.protein.bio.msu.ru/ )

• CONAN-m

... Preliminary evaluation of forest ecosystems' state near the smelter was made, the monitoring methodology for polluted areas was developed, and critical loads of acid deposition were assessed (see also soil.msu.ru/projects/acidification/ ). ... The new built up database on forest ecosystem data for permanent monitoring plots was used for analysis of soil chemical state in forest ecosystems subjected to airborne pollution in the fragile boreal environment in the Norwegian-Russian border area. ...

Еще в разделе: (Показать все результаты (>22) - eco.soil.msu.ru/ )

• MULTIVARIATE ANALYSIS OF SOIL CHEMICAL PROPERTIES
• Effects of Acid Deposition on Forest Soils in Northernmost Russia: Modelled and
• Koptsik G.N., et al. Response of pine forests to long-term air pollution at the

astro-ph/0207098 . ... Comments: 69 pages plus 17 figures, submitted to ApJ . Значительная часть межзвездной среды находится в виде нейтрального водорода. ... astro-ph/0207104 . ... Comments: 70 pages, 20 figures. astro-ph/0207105 . ... Comments: 65 pages, 16 figures . ... Comments: 21 pages, 16 figures, instructions for downloading software . ... Турбулентность в межзвездной среде: энергетика и поддерживающие механизмы (Turbulence in the Interstellar Medium: Energetics and Driving Mechanisms) . ...

Еще в разделе: (Показать все результаты (>310) - astro.uni-altai.ru/ )

• http://xray.sai.msu.ru/~polar/sci_rev/1511.html
• http://xray.sai.msu.ru/~polar/sci_rev/0308.html

... Cleo batch system is purposed to control parallel tasks on computer clusters. It controls one or more task queues. tasks sceduling (all MPI implemetations are supported, most other parallel environments are supported too) . ... controllable user limits (max used cpus, task work time, etc.) . ... Any task in main will be queued to daughter queues if there aren't enough free own cpus (not shared with daughters). When daughter queues will get enough cpus for this task, it will be runned in main . ...

200. Comet Observation Home Page (Chernogolovka)