... Assume that gas is a thermodynamic system in the state of local equilibrium, that is, it is satisfied the relation [2] [pic] (1) There [pic],[pic] and [pic] are the temperature, the pressure and the gas volume, [pic], [pic] are entropy and internal energy per unit volume. ... Let us consider the first-degree form [pic]. ... Since the evolutionary relation is not identical, from this relation one cannot get the state differential [pic] that may point to the equilibrium state of the material system. ...

Еще в разделе: (Показать все результаты (>12) - hit-conf.imec.msu.ru/ )

... We calculate field dependence of the electron drift velocity using several sets of the material parameters that can be found in the literature, and the results are compared with the available experimental data. ... 0 2 Electronic mail: dmitriev@lt.phys.msu.su. ... The calculated field dependence of the drift velocity vd for different sets of InN material parameters, the lattice temperature is 77 K, the free electron, and doping concentrations are 9 1018 cm-3. ... Phys. 109, 023706 2011 FIG. ...

Еще в разделе: (Показать все результаты (>14) - lizard.phys.msu.su/ )

University Satellites and . Space Science Education . ... Practical Training for Students in Simulated Satellite Navigation and Attitude Determination for Universitetskiy-Tatyana Satellite - an Overview . ... The practical training has been developed to provide a basic introduction for students into satellite navigation, satellite motion in space, Kepler orbits, and computational techniques involved in dealing with problems of navigation. ...

Еще в разделе: (Показать все результаты (>22) - cosmos.msu.ru/ )

• Space Scientific and Education project of Lomonosov Moscow State University -

Serge Moscovici . Social Representations mailing list 1 postings, 28 Apr - 27 May 1997 . ... Deriabin wonders why social constructionism and social representations do not get close to one another. ... I cannot see where and how the theory of social representations has been rewritten to fit the cognitive paradigm. ... What is important for me now, at this point of my thinking, is the following: without a theory of social representations, we cannot understand social construction. ...

Еще в разделе: (Показать все результаты (>9) - psyberlink.flogiston.ru/ )

Published on Department of the Automation for Scientific Research CMC MSU ( http://ani.cmc.msu.ru ) . ... Alexander Valeryevich POZDNEEV (November 22, 1983, Novosibirsk, Russia) тАФ teaching assistant (assistant professor). Graduated with honours from the Faculty of Computational Mathematics and Cybernetics (CMC) at Lomonosov Moscow State University (MSU) (2006). Succesfully completed postgraduate study at the Faculty of CMC at Lomonosov MSU (2009). ... A.V. Pozdneev. ...

Еще в разделе: (Показать все результаты (>12) - ani.cmc.msu.ru/ )

• Alexander Valeryevich Pozdneev | Department of the Automation for Scientific
• The ASR Department at the CMC Faculty of Lomonosov MSU | Department of the

... Выпускники . ... Женский клуб . ... Издательство МГУ . ... Выпускники МГУ . ... Дайв-Клуб МГУ . ... В штаб-квартире ЮНЕСКО в Париже пройдет семинар , организованный нобелевским лауреатом Люком Монтанье (Luc Montagnier) и посвященный спорной теории этого вирусолога: о том, что вода способна хранить и передавать информацию с помощью электромагнитных 'следов' ДНК и других молекул, ранее растворенных в жидкости. Это мероприятие вызвало бурную реакцию среди борцов с псевдонаукой, сообщает Science News. ...

Еще в разделе: (Показать все результаты (>194) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Клетки кожи стали клетками мозга в один ход
• Клуб выпускников МГУ: Стритрейсер ранил двух девушек в ДТП на Воробьевых горах
• Клуб выпускников МГУ: Кайя Кальпа: продление жизни и бессмертие

... In addition to the direct effect of acidic solutions on tree crowns, resulting in tissue damage and leaching of metabolites, the acid impact modify soil properties, which is believed to be the most important in forest degradation. ... We assessed critical loads of acid deposition and their exceedance for forest soils in the European part of the former Soviet Union using a simple balance method and mapped them within 1.0°x0.5° longitude per latitude grid cells. ...

Еще в разделе: (Показать все результаты (>20) - eco.soil.msu.ru/ )

• Pine Needle Chemistry near a Large Point SO2 Source in Northern Fennoscandia
• Spatial Variability of Podzol Properties in Forest Ecosystems under Air
• MULTIVARIATE ANALYSIS OF SOIL CHEMICAL PROPERTIES

... School problem is extremely important. ... Our President has mentioned the territorial disparity, i.e. two-thirds of our schools are the rural schools and their graduates are at unequal terms with their equals from cities' schools to get following education. ... Create special conditions in education for disabled children, for orphans and children from unfortunate families, pupils from rural schools and gifted children. ... Ensure social equity for all children during school education and after it. ...

Еще в разделе: (Показать все результаты (>33) - www.rsr-online.ru/ )

• About The Russian Union of Rectors

... 2 (1997) 147-157 PRINCIPAL TRENDS IN MODERN ECOLOGY AND ITS MATHEMATICAL TOOLS: AN ANALYSIS OF PUBLICATIONS* E. V. BUDILOVA, J. A. DROGALINA, A. T. TERIOK.HIN Department of Biology, Moscow State University, Moscow 119899 (Russia) E-mail: lenl@ATeriokhin.home.bio.msu.ru (Received March 12, 1997) The paper deals with a scientometric analysis of publications from the journals Ecology and Ecologia (Russia) based on the ... Keywords of group С are encountered in 17% and В in 11% of papers. ...

Еще в разделе: (Показать все результаты (>28) - ecology.genebee.msu.ru/ )

• http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/2004_Birthweight_JEvolBio.pdf
• http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/2003_Envir_human_EER.pdf
• http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/1999_Seasons_EER.pdf

Visual Images of Patriarch Nikon: An Electronic Gallery" consists of nearly fifty artistic depictions of patriarch Nikon and their full bibliographic citations. 2 The gallery evolved out of my dissertation "Patriarch Nikon's Image in Russian History and Culture" (Western Michigan University, 2004) and embodies my main argument that Nikon's resonance in Russian history remains largely unrecognized because traditional histories ? ... Nikon was officially rehabilitated shortly thereafter in 1682. ...

Еще в разделе: (Показать все результаты (>3259) - hist.msu.ru/ )

• A. Gow. Gog and Magog
• P h o t o A r c h i v e
• "Novaya i noveishaia istoria" Journal

The quantitative probabilistic model of the solar energetic particle fluxes description by R.A.Nymmik from Skobeltsyn Institute of Nuclear Physics, Lomonosov Moscow State University, 119991, Moscow, Russian Federation, nymmik@sinp.msu.ru Abstract The description of a quantitative probabilistic model for peak fluxes and fluences of solar energetic particles from protons up to Ni ions is presented. ... Nymmik R.A. Probabilistic model for fluences and peak fluxes of solar energetic particles, Rad. ...

Еще в разделе: (Показать все результаты (>12) - smdc.sinp.msu.ru/ )

. Print . Details . Written by Ольга Жулябина . Published: 29 November 2015 . Sorry, this page has no english version.

Еще в разделе: (Показать все результаты (>36) - engineering.phys.msu.ru/ )

• Science Festival 2015
• X Congress of Russian Rectors Union
• One day in a lab

. November 999 . Mon . Tue . Wed . Thu . Fri . Sat . Sun . 1 . 2 . 3 . 4 . 5 . 6 . 7 . 8 . 9 . 10 . 11 . 12 . 13 . 14 . 15 . 16 . 17 . 18 . 19 . 20 . 21 . 22 . 23 . 24 . 25 . 26 . 27 . 28 . 29 . 30 .

Еще в разделе: (Показать все результаты (>4489) - fmp.msu.ru/ )

• http://fmp.msu.ru/index.php?option=com_k2&view=itemlist&task=calendar&month=11&year=10&catid=35&Itemid=1165
• http://fmp.msu.ru/index.php?option=com_k2&view=itemlist&task=calendar&month=11&year=100&catid=35&Itemid=1165
• http://fmp.msu.ru/index.php?option=com_k2&view=itemlist&task=calendar&month=11&year=1000&catid=35&Itemid=1165

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>15) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/insilicobiol_2003.pdf
• Кавказ

... The Informativeness of Coherence Analysis in EEG Studies A. P. Kulaichev UDC 612.821.6 Translated from Zhurnal Vysshei Nervnoi Deyatel'nosti imeni I. P. Pavlova, Vol. ... KEY WORDS: coherence, spectral analysis, EEG non-stationarity, amplitude modulation. ... In particular, the two fundamental differences between EEG signals and most other physical signals are not considered: a) fundamental non-stationarity; b) amplitude modulation at all frequency ranges. ... Coherence in technical addenda. ...

Еще в разделе: (Показать все результаты (>11) - www.protein.bio.msu.ru/ )

• http://www.protein.bio.msu.ru/~akula/Kulaichev%20Addition.pdf

... Предыдущее сообщение: PARALLEL.RU - Новости, специальный выпуск [16/11/2010] . ... Выпуск 298 . 23 ноября 2010 г. ------------- 1 декабря 2010 заканчивается срок представления аннотаций докладов на Международную научную конференцию Параллельные вычислительные технологии (ПаВТ) 2011 . http ://agora.guru.ru/pavt ------------- На странице Научного семинара PARALLEL.RU выложены ссылки на видеозапись выступления Томаса Стерлинга в НИВЦ МГУ имени М.В.Ломоносова 1 ноября 2010 года ...

Еще в разделе: (Показать все результаты (>9) - mail.parallel.ru/ )

• PARALLEL.RU - Новости, выпуск #336 [27/11/2012]
• PARALLEL.RU - Новости, выпуск #318 [27/12/2011]

... In this Letter we investigate both theoretically and experimentally angular (momentum) structure of SPDC biphoton coincidence and single-photon distributions, with special attention paid to a proper account of the anisotropy effects. Namely, it turns out that the biphoton coincidence angular distributions depend strongly on the crystal orientation. ... FIG. ... Entanglement. ... Here the widths of single and coincidence distributions are 60 mrad and 0.75 mrad, correspondingly. ... Phys. Rev. Lett. ...

Еще в разделе: (Показать все результаты (>61) - qi.phys.msu.ru/ )

• http://qi.phys.msu.su/papers/2006-lasphys-16-1264.pdf
• http://qi.phys.msu.ru/papers/2009-epl-87-64003.pdf
• http://qi.phys.msu.ru/kulik/Papers/hooks.pdf

Wanted to Know about Log Periodic Power Laws for Bubble Modelling but Were Afraid to Ask (with P. Geraskin) (in) NONLINEAR FINANCIAL ECONOMETRICS: Mark ov Swit ching Models , Persist ence and Nonlinear Coint egrat ion, Palgrave Macmillan, p. 104- 123, (2011) Fractionally Integrated Models for Volatilit y: A Review (in) FINANCIAL ECONOMETRICS MODELING: Mark et Microst ruct ure, Fact or Models and Financial ...

Еще в разделе: (Показать все результаты (>20) - www.mse-msu.ru/ )

• http://www.mse-msu.ru/Ayvazyan_Introduction_to_the_textbook_on_econometrics.pdf
• http://www.mse-msu.ru/Maevsky,%20Zorin%20-%20Managed%20monetary%20accelerator.pdf
• http://www.mse-msu.ru/files/k1205.pdf

... XXXI Конгресс Международной ассоциации гидрогелогов "New Approaches to Characterising Groundwater Flow" . ... XXXI Конгресс Международной ассоциации гидрогелогов "New Approaches to Characterising Groundwater Flow" будет проходить 10 сентября 2001 года в Германии, Мюнхен. ...

Еще в разделе: (Показать все результаты (>147) - www.nature.web.ru/ )

• Научная Сеть - Scientific Network
• Состояние цитокинового статуса больных в разные периоды травматической болезни

... 1+2 N=2 4 4 3 Intensity i 2 1 0 0 0 0 0.01 0.02 anglei 0.03 0.04 .05 N=5 25 25 20 15 Intensityi 10 5 0 0 0 0 0.01 0.02 anglei 0.03 0.04 .05 N=10 100 100 80 60 Intensityi 40 20 0 0 0 0 0.01 0.02 anglei 0.03 0.04 .05 I() /l N-1 -2/d -/d 0 /Nd /d 2/d m/d sinx­sin0 x I() N-1 -2/d -/d 0 /d /Nd I() 2/d /l m/d sinx­ sin0x m d(n - 1) /d /Nd -2/d -/d 0 /d 2/d m/d sinx­ sin0x 4. ...

Еще в разделе: (Показать все результаты (>14) - genphys.phys.msu.su/ )

• http://genphys.phys.msu.su/rus/sci/photonics/PDF/4(en).pdf