Call Title: Call for proposals for ERC Starting Independent Researcher Grant Call identifier: ERC -2012-StG Date of publication: 20 July 2011 Electronic proposal submission deadlines1 (single submission of full proposal): 2 Domain Physical Sciences Engineering (Panels PE1 - PE10): 12 October 2011, 17.00.00 (Brussels local time) Domain Life Sciences (Panels LS1 ­ LS9): 9 November 2011 17.00.00 (Brussels local time) Domain Social ... See section 4.6 and Annex 9 of the work programme. ...

Еще в разделе: (Показать все результаты (>31) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/call_SyG_2012.pdf
• http://ideas.msu.ru/docs/AdG_call_2010.pdf
• http://ideas.msu.ru/news/19_10_2010/Press_release.pdf

.. . .. · · « » · · , . · ( ), ­ . · ( ­ - ). · ( , conveying machines), () . · · ( ­ ­) (­ ) , · , , · -, · , · - - , · . · C ( ) · 1) ­ : · , · , . · 2) , · ­ : · , , , , . · 3) : · , · . · , , · . · , . · ( ) . . - - 70S V.Ramakrishnan, Nature, October 29, 2009 in vivo. . 30S 50S . © 2009 Nature Publishing Group. Published by Nature Publishing Group. Ratchet movement can cause the helices rotation that changing the GAC position 2058 . . . 2009 .. . ..

Еще в разделе: (Показать все результаты (>16) - nano.msu.ru/ )

• Statute on the Methodical Commissions of the MSU Nanotechnology Education and
• Molecular physiology | Научно-образовательный центр по нанотехнологиям МГУ
• Новости | Научно-образовательный центр по нанотехнологиям МГУ

... Полная версия этой страницы: PhD position in Sheffield . Студенческий форум Физфака МГУ > Общий > Работа . ... PhD positions in semiconductor physics . Several PhD positions will be available from October 2005 in Semiconductor Physics Group at Sheffield, UK. We are a world ranking group, which is very well equipped for top quality research. ... уже много желающих, но мало квалифицированных желающих......) d.krizhanovskii@sheffield.ac.uk . ... 19.3.2007, 16:57 . ... мат +2 Kirilll . ...

Еще в разделе: (Показать все результаты (>908) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Системный администратор
• Студенческий форум Физфака МГУ > current любимая реклама
• Студенческий форум Физфака МГУ > Работа в Samsung Electronics для математиков и

. GROUP AUTUMN 1992 (approximately October) . From the left: Ardak Kusainova (as PhD student), Dr. Lydmila N. Kholodkovskaya , Peter S. Berdoosov (as diploma student), Dr. Valery A. Dolgikh and Dmitri O. Charkin (student) . Back

Еще в разделе: (Показать все результаты (>29) - www.inorg.chem.msu.ru/ )

• Группа гидротермального синтеза :: Публикации
• Group of Hydrothermal Synthesis :: Articles
• Division Colloquia - Inorganic Chemistry Division - Chemistry Department -

Published on Department of the Automation for Scientific Research CMC MSU ( http://ani.cmc.msu.ru ) . ... Alexander Valeryevich POZDNEEV (November 22, 1983, Novosibirsk, Russia) тАФ teaching assistant (assistant professor). Graduated with honours from the Faculty of Computational Mathematics and Cybernetics (CMC) at Lomonosov Moscow State University (MSU) (2006). Succesfully completed postgraduate study at the Faculty of CMC at Lomonosov MSU (2009). ... A.V. Pozdneev. ...

Еще в разделе: (Показать все результаты (>5) - ani.cmc.msu.ru/ )

• Alexander Valeryevich Pozdneev | Department of the Automation for Scientific

. Eduard L. Nagaev . Scientific heritage . Eduard L. Nagaev, Selection . Fizmatlit, Moscow, 2004, 320 pp. Content (in Russian) . Nagaev's complete list of books, reviews, and papers (Rus + Eng) . Если Вам нужна книга "Избранных трудов" или/и копии любых статей из этого списка, обращайтесь, пожалуйста: tsir@elch.chem.msu.ru . Please, contact me if you need this book or/and any copies of papers from this list: tsir@elch.chem.msu.ru . Back

Еще в разделе: (Показать все результаты (>55) - electr003.chem.msu.ru/ )

• Pronkin Sergey Nikolayevich
• Vladimir Sergeevich Bagotsky
• Inorganic Barrier Layers: Electron Transfer on Mercury Modified by Tungstate

... This project is designed to provide students with first-hand experience in intercultural communication with their peers from another culture (country) using the most advanced electronic communivation technologies. б Specifically, students will work together in small groups comprised of MSU and Geneseo students to meet a challenge of collaborative project. ... Administrator: Mira Bergelson . Administrator: Corey Ha . Teacher: Mira Bergelson . Teacher: Corey Ha . ...

Еще в разделе: (Показать все результаты (>10563) - moodle.ffl.msu.ru/ )

• Moodle ФИЯР МГУ

... Find the Brillouin zone for a 2D honeycomb lattice (lattice parameter d) and transform it into a hexagon. ... Compare the energies and the RMS charge radii electrons, in units of e). 1 2 (r )d3 x thus obtained ((x) is the total charge density of two 4. Find the density profile n(r) for an atom with the nucleus charge -Z e using the Thomas­ Fermi equation. ... Introducing the wavefunction (x) containing the low-energy degrees of freedom, find the effective wave equation for it. ...

Еще в разделе: (Показать все результаты (>5) - theorphys.phys.msu.ru/ )

• Сарданашвили Геннадий Александрович

... Форумы > Первокурсникам > Тема . Автор темы gecko . Форумы Список тем Новая тема . ... Си - полезная информация . ... Ответить Цитировать . ... Помогите, пожалуйста, написать программу копирования ввода на вывод с заменой строки из одного и более пробелов на один пробел с использованием функций getchar() , putchar() и операторов цикла while или for. ... bool prev_space = false; . while (c= getchar() ) . ... Сайт работает с 29.08.2000, Copyright 2000 2011 MMOnline.Ru and MMForce.Net, . ...

Еще в разделе: (Показать все результаты (>89) - www.mmonline.ru/ )

• MMOnline | Форумы | Разное | Футбол : Эта, народ, to whoam it may concern.
• MMOnline | Форумы | Аспирантура | Аспирантура в Порту, Португалия
• MMOnline | Форумы | Разное | Книги на сайте

... Начало www.99ru.ru Другое 6242 . ... Введите код товара из каталога. автор 1984 . ... 6242 . 1984 . ... Brick 2 x 4 Красный 8 X Brick 2 x 4 Синий 2 X Train Weight 2 x 6 x 2 - bottom openings, center seam on short sides Красный 24 X Technic , Brick 1 x 2 with Hole Красный 24 X Technic , Brick 1 x 2 with Hole Синий 24 X Technic , Brick 1 x 4 with Holes Синий 16 X Technic , Brick 1 x 4 with Holes Красный 4 X Technic , Brick 1 x 6 with Holes Синий 4 X Technic , ...

Еще в разделе: (Показать все результаты (>14) - www.bukivedi.ru/ )

• www.99ru.ru - Racine J. 1554
• www.99ru.ru - Джон Бейли 4417
• www.99ru.ru - PRIJATELJ, KRUNO 1159

... Academic Programmes . ... For Teachers . ... Vestnik CIE (in Russian) . ... Russian Teachers Training Programmes . ... The Center provides teacher training in the field of Russian as a foreign language to enhance the efficiency and effectiveness of the instructional process. ... We offer lessons on methodology of teaching Russian as a foreign language. ... The course of professional retraining (1 2 semesters) for getting a new qualification: Teacher of Russian as a foreign language is offered. ...

Еще в разделе: (Показать все результаты (>24) - www.cie.ru/ )

• Admissions :: CIE
• ATTENTION!
• Apply Online

... News . About choir . ... Performance the Academic Choir of the Moscow State University in Crocus City Hall . ... Bishop Tikhon opened the choir of Moscow State University in Vienna . Choir of Moscow State University spoke at the Vienna branch of the United Nations . ... Posted in: News . Sorry, this entry is only available in Русский . ... Older Entries . ...

Еще в разделе: (Показать все результаты (>2) - new.choir.msu.ru/ )

... Dmitry Stepanovich (VIDEO of March 2011) . Olga Silchenko, a soloist of the Early Music Theatre . ... Anna and Olga Silchenko have presented the duets by Rubinstein and Chaikovsky (VIDEO) . ... Two Russian romances - duets by Olga Silchenko and Dmitry Stepanovich (VIDEO) . ... N. Rimsky-Korsakov "The Tsar's Bride", the duet of Lubasha and Gryaznoy - by Olga Silchenko and Dmitry Stepanovich (VIDEO) . ... Vivaldi "Magnificat", 6th part, duet by Anna and Olga Silchenko (VIDEO) . ... Olga Silchenko . ...

Еще в разделе: (Показать все результаты (>48) - sn.sai.msu.ru/ )

V.S. Chernysh, A.A. Haidarov, V.S. Kulikauskas. ... V.C. Chernysh, W. Eckstein, A.A. Haidarov, V.S. Kulikauskas, V.A. Kurnaev, E.S. Mashkova, V.A. Molchanov. ... В.С. Куликаускас, Е.С. Машкова, В.А. Молчанов, А.А. Хайдаров, В.С. Черныш, В. Экштайн. ... Поверхность, 1999, ?4. ... V.C. Chernysh, W. Eckstein, A.A. Haidarov, V.S. Kulikauskas, E.S. Mashkova, V.A. Molchanov. ... V.S. Kulikauskas, E.S. Mashkova, V.A. Molchanov, A.A. Haidarov V.S. Chernysh and W. Eckstein. ... Поверхность. ...

Еще в разделе: (Показать все результаты (>3) - physelec.phys.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/insilicobiol_2003.pdf

... Loskutov, and E. V. Ryadchenko Presented by Academician A.R. Khokhlov April 22, 2005 Received April 26, 2005 The problem of the identification and biological significance of chromosome fragments and complete genomes is approached on the basis of the representation of a sequence of DNA nucleotides as a two-dimensional walk. ... However, as applied to DNA, functional and structural fragments of a chromosome may be distinguished by a typical walk "pattern" only for a sufficiently large number of units....

Еще в разделе: (Показать все результаты (>58) - chaos.phys.msu.ru/ )

• http://chaos.phys.msu.ru/loskutov/PDF/Nonli_phen_Compl_Systems.pdf
• http://chaos.phys.msu.ru/loskutov/My_hobbies/Photography/Examples/Scanned_slides+photos/Autumn_birch_forest.htm
• Science

Preliminary results of astroclimate parameters measurements at the Sternberg 2.5m telescope installation site V.Kornilov, N.Shatsky, S.Potanin, O.Voziakova, B.Safonov Moscow, 2008 Acknowledgements A.Belinskiy M.Kornilov A.Tokovinin M.Kuznetsov P.Kortunov E.Gorbovskoy SAI administration some SAI students Pulkovo solar station (KHSS) staff RFBR support MAVEG Gmbh Why to study optical turbulence and some other relevant ... Mean seeing by DIMM data for this night is 1''5. ...

Еще в разделе: (Показать все результаты (>18) - curl.sai.msu.ru/ )

• . The . MASS . Group .

... Individual SELEX products, aptamers, are small molecules (40­100 nt) that have a unique three-dimensional structure, which provides for their specific and high-affinity binding to targets varying from low-molecular-weight ligands to proteins. ... Selection of aptamers binding with a target is the key step in SELEX, as aptamers account for only a small fraction of the initial library (one aptamer per 109 to 1013 molecules) [6]. ... Fourth, modification can increase the aptamer affinity for a target. ...

Еще в разделе: (Показать все результаты (>4) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.ru/pages/pdf/nar2004.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2002_1.pdf
• http://rnp-group.genebee.msu.su/pdfs/febsz.pdf

Автор: Роберт Джонсон . Опубликовано: October 21, 2002, 12:25 am . Ключевые слова (теги): книги , скачать книги , аналитическая психология , аналитическая психотерапия , юнгианский анализ . ... ОНА Глубинные аспекты женской психологии . Рождение Психеи | ... Статьи автора . ... Блоггерам - код красивой ссылки для вставки в блог . Информация об авторе: Роберт Джонсон . ... Флогистон / библиотека по психологии / "ОНА" Глубинные аспекты женской психологии . ... 23 Роберт Джонсон . ...

Еще в разделе: (Показать все результаты (>58) - www.flogiston.ru/ )

• Московский Психотерапевтический Журнал | mpj
• Как поставить на нас ссылку (наши баннеры и кнопки) | Константин Ефимов

... Professors: Corresponding member of RAS S.A.Dobrolubov (water masses, ocean and atmosphere interaction), corresponding member of RAS S.K.Gulev (ocean and atmosphere interaction), academician of RAS A.S.Sarkisian (sea currents theory); . ... Data bases have been created: for Caspian Sea hydrological and hydrochemical observations in the second half of the XX century involving more than 70 thousands of oceanologic stations; for Black Sea about 60 thousands stations with thermohaline observations. ...

Еще в разделе: (Показать все результаты (>28) - eng.geogr.msu.ru/ )

• Publications
• Department of Social-Economic Geography of Foreign Countries
• Department of Biogeography