Alexander P. Seyranian . Institute of Mechanics , . Moscow State Lomonosov University , . ... Phone: (7495) 939 2039 . Fax: (7495) 939 0165, 939 2065 . ... My field of specialization are Stability Theory, Parametric Resonance, Gyroscopic Stabilization, Mechanics of Solids, Structural Optimization, Singularities and Bifurcations. ... Technical University of Denmark . Aalborg University, Denmark . ... Institute of Engineering Mechanics and Systems, University of Tsukuba, Japan . ...

Еще в разделе: (Показать все результаты (>3) - seyranian.imec.msu.ru/ )

О лаборатории . ... Лаборатория теоретической биофизики . ... The manual to FireFly program clearly explain why and how to use spherical or cartesian functions when working with different basis sets. ... The $D5 group provides further control through the D5, F7, and G9 keywords, which pertain to d, f, and g functions, respectively. ... Quantum chemistry information page ERG Research Group: Лаборатория теоретической биофизики написал (Май 19th, 2015 5:52 пп) . ... 2014 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>58) - erg.biophys.msu.ru/ )

• OPLS-AA patch for different types of molecules ERG Research Group: Лаборатория
• comcon1 ERG Research Group: Лаборатория теоретической биофизики
• Gaussian Cube files loader ERG Research Group: Лаборатория теоретической

Nuclear Instruments and Methods in Physics Research B 206 (2003) 830­837 www.elsevier.com/locate/nimb Gas cluster ion beam applications and equipment Allen Kirkpatrick * Epion Corporation, 37 Manning Road, Billerica, MA 01821, USA Abstract Interactions of gas cluster ions with solid surfaces, and prospective applications for those interactions, have been research topics of interest for several years. ... Cluster ion surface interactions Fig. 3 shows a simple representation of cluster impact. ... Fig. ...

Еще в разделе: (Показать все результаты (>111) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/LIIWM/JPhysB40_2007_2163Kab.pdf
• http://danp.sinp.msu.ru/LIIWM/JPhysB_40_3413_07KabachKazanski.pdf
• http://danp.sinp.msu.ru/LIIWM/JPhys_ConfSer194_8_082007_VAKho.pdf

The Converter of Measurement Units is aimed to converting of measurement units between different systems of measurement, for example from British-American units of measurement to metric system and vice versa. To convert a value . ... On the left panel list select a measure you want to convert . ... Select the measurement unit you want to convert from . ... Select the measurement unit you want to convert to . ... Result is displayed in the "Conversion Result" area. ...

Еще в разделе: (Показать все результаты (>24) - sbmg.geol.msu.ru/ )

• Departement of Regional Geology and Earth History

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/genome_biol_evol_2014.pdf
• Roman Sutormin. Home Page

Nanoterrorism: New Responsibility for Our World and Future in the Global TechnoScience Vitaly G. Gorokhov Institute for Philosophy of the Russian Academy of Sciences, Institute of Technology Assessment and Systems Analysis of the Research Center Karlsruhe (Germany) Vitaly.Grorokhov@itas.fzk.de "Bioterrorism and chemical warfare are not unthinkable. ... 2] But these conditions do not else exist for the time being in nanoscience and nanotechnology. ...

Еще в разделе: (Показать все результаты (>10) - iisi.msu.ru/ )

• http://www.iisi.msu.ru/UserFiles/File/bayern2009/global_dns.pdf
• http://www.iisi.msu.ru/UserFiles/File/bayern2009/twomey.doc
• http://www.iisi.msu.ru/UserFiles/File/Terminology%20IISI%20EWI/Russia-U%20S%20%20bilateral%20on%20terminology.pdf

... 18 27 апреля 2016 года . ... СЕМИНАР ПО МЕХАНИКЕ СПЛОШНЫХ СРЕД . В среду, 13 апреля 2016 г., в кинозале Института механики МГУ в 12.00 состоится очередное заседание семинара по механике сплошных сред под руководством А.Г. Куликовского, В.П. Карликова и О.Э. Мельника. ... версия для печати 2016-04-07 . ... 260 заседание семинара ?Физико-химическая кинетика в газовой динамике? состоится в четверг 07 апреля 2016 года (11 часов, кинозал Института механики МГУ) . ... НИИ механики МГУ, 2002 2016. ...

Еще в разделе: (Показать все результаты (>4) - www.imec.msu.ru/ )

EUROPEAN C O MM ISS ION Community r esear c h FP7 in Brief How to get involved in the EU 7th Framework Programme for Research a pocket guide for newcomers Europe Direct is a service to help you find answers to your questions about the European Union Free phone number from any Member State: 00 800 6 7 8 9 10 11 Chargeable number from anywhere else in the world. ... In order to complement national research programmes, activities funded from FP7 must have a "European added value". ...

Еще в разделе: (Показать все результаты (>37) - ideas.msu.ru/ )

• http://www.msu.ru/int/newpr/7ram/7ram_napr.pdf
• http://ideas.msu.ru/docs/Work_programme_2011.pdf
• http://www.msu.ru/int/newpr/7ram/7ram_prez.pdf

... Search for Single Top Quark Production at DZero using Neural Networks" . ... Search for Single Top Quark Production at D0 Using Neural Networks" . ... Search for Electroweak Production of Single Top Quarks" . ... Use of Neural Networks in a Search for Single Top Quark Production at D0", . ... Search for Single Top Quark Production at the Tevatron" . ... Use of Neural Networks in a Search for Single Top Quark Production with the DZero Detector at the Fermilab Tevatron Collider", . ...

Еще в разделе: (Показать все результаты (>8) - top.sinp.msu.ru/ )

• Lev V. Dudko Home Page

... 1 The publication of this monumental work provides an appropriate occasion for reexamining the meaning of certain problematic Luwian lexemes and constructions. ... Hieroglyphic Luwian (HLuw.) remained the only written language in Anatolia for several centuries, until the conquest of Neo-Hittite states by Assyria and possibly the spread of alphabetic writing brought an end to the hieroglyphic scribal tradition. ... A very cautious approach is adopted with regard to translation. ... VAS")a-tara/i-i-na...

Еще в разделе: (Показать все результаты (>17) - imk.msu.ru/ )

• http://www.imk.msu.ru/Structure/Linguistics/yakubovich/download/palaic1.pdf
• http://www.imk.msu.ru/Structure/Linguistics/yakubovich/download/refl-ucla.pdf
• Vyach. Vs. Ivanov. Institute of World Culture

Review articles SINE insertions: powerful tools for molecular systematics Andrew M. Shedlock 1,2 and Norihiro Okada1* Summary Short interspersed repetitive elements, or SINEs, are tRNA-derived retroposons that are dispersed throughout eukaryotic genomes and can be present in well over 104 total copies. ... 2A), only one or perhaps a few highly active "master" SINE loci are capable of amplification, giving rise only to non-propogating offspring copies. ... 4) Independence of SINE insertions. ...

Еще в разделе: (Показать все результаты (>68) - vertebrata.bio.msu.ru/ )

• Student Reports at International Conferences
• Выступления студентов и аспирантов на конференциях

... L Сd , Pol a nd ABOUT EFFECTIVE MODES METHOD FOR DESCRIPTION OF INTERNAL DYNAMICS OF WEAKLY BOUND CLUSTERS Elena Belega, Evgeny Cheremukhin 1 , Dmitry Trubnikov Abstract: New approach to describe the internal dynamics of weakly bound clusters is presented. ... It is found that the number of active collective modes depends on the initial cluster excitation and that the internal energy is partitioned nonuniformly among the modes. ... Collective motion of oxygen atoms performs mostly in plane. ...

Еще в разделе: (Показать все результаты (>22) - beams.chem.msu.ru/ )

• Сверхзвуковые струи - Лаборатория молекулярных пучков МГУ
• Сотрудники - Ларин Александр Владимирович

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>14) - tukachev.flogiston.ru/ )

• Category: Новости

Institute of Mechanics , . Lomonosov Moscow State University , . ... Phone: +7 495 939 2039 . Fax: +7 495 939 0165 . E-mail: mailybaev imec.msu.ru . ... Mathematics . stability theory and dynamical systems . ... Physics and Mechanical Engineering . ... Engineering Faculty, University of l'Aquila, Italy . ... Department of Engineering Mechanics, Dalian University of Technology, China . ... Institute of Engineering Mechanics and Systems, University of Tsukuba, Japan . ...

Еще в разделе: (Показать все результаты (>33) - mailybaev.imec.msu.ru/ )

... Gaseous discs in NGC 252 and in NGC 4513 have decoupled kinematics, and the ionized gas of their rings is certainly excited by young stars. ... Two other, quite isolated S0 galaxies with the UV rings, IC 522 and NGC 446, demonstrate the shock-dominated gas excitation in the UV-detected rings, so their rings may probably have impact origin. ... NGC 4513. ... The UV rings in isolated galaxies IC 522 and NGC 446 may represent the consequences of central impact by a satellite from a highly inclined...

Еще в разделе: (Показать все результаты (>49) - sn.sai.msu.ru/ )

• Olga Silchenko
• Recent publications

... История кафедры . ... S. Auclair, R. Uzbekov, S. Elis, L. Sanchez, I. Kireev, L. Lardic, R. Dalbies-Tran, and S. Uzbekova. ... I. Vorobjev, K. Buchholz, P. Prabhat, K. Ketman, E. Egan, M. Marti, M. Duraisingh, and N. Barteneva. ... Belmont AS, Hu Y, Sinclair PB, Wu W, Bian Q, Kireev I. Insights into Interphase Large-Scale Chromatin Structure from Analysis of Engineered Chromosome Regions. ... Цитология, (2010), т. 52, ? ... Hu Y., Kireev I., Plutz M., Ashourian N., Belmont AS. ... 2008), 5(4):311...

Еще в разделе: (Показать все результаты (>3) - cytol.bio.msu.ru/ )

... О факультете . Структура факультета . ... Научная работа . ... Коллеги, у Вас есть возможность публиковать научные статьи в Peer-Reviewed Open Access Journals: . Журнал ?Международные научные публикации: Экология и Безопасность (ISP:ES), Том 5, ISSN: 1313-2563 . Журнал ?Международные научные публикации: Материалы, Методы и Технологии (ISP:MMT), Том 5, ISSN: 1313-2539 . ... Д 501.001.20 - все защиты . ... все защиты ? ... Биологический факультет МГУ . ... 2016 Биологический факультет . ...

Еще в разделе: (Показать все результаты (>10) - www.bio.msu.ru/ )

• Master In Ecology ? Биологический факультет МГУ

Revised: 21 May 2014, Accepted: 27 May 2014, Published online in Wiley Online Library (wileyonlinelibrary.com) DOI: 10.1002/jmr.2399 Force -induced globule-coil transition in laminin binding protein and its role for viral- cell membrane fusion Boris N. Zaitseva, Fabrizio Benedettib,e, Andrey G. Mikhaylovb, Denis V. Korneeva, Sergey K. Sekatskiib*, Tanya Karakouzb, Pavel ... 2008, 2010). ... This should permit us to elucidate still unclear aspects of viral-cell membrane interaction and fusion. ...

Еще в разделе: (Показать все результаты (>4) - cell.biophys.msu.ru/ )

Вы посетили: arzhantsev_s_a_publications . ... История кафедры . ... On restriction of roots on affine T-varieties, Beitr?ge zur Algebra und Geometrie / Contributions to Algebra and Geometry 55 (2014), no. ... Journal of Pure and Applied Algebra 218 (2014), no. ... Сибирский математический журнал 53 (2012), вып.6, 1354-1372 . ... Математический Сборник 203 (2012), вып.4, 47-60 . ... staff/arzhantsev_s_a_publications.txt Последние изменения: 10.05.2015 22:32 От arjantse | ...

Еще в разделе: (Показать все результаты (>25) - halgebra.math.msu.su/ )

• staff:arzhantsev_publications | Кафедра высшей алгебры

... Advanced chapters of operation research . Algebraic characterization of basic solution of linear program. ... Advanced chapters of Actuarial Mathematics . ... Discounted cash flow analysis and capital budgeting as decision tools are given particular emphasis. ... In the first part of the course we present a modern approach to modeling economic systems. ... The problem of tax optimization under a given financing budget. ... Магистратура: master@cmc.msu.ru, 3-й этаж, комната 360, тел. ...

Еще в разделе: (Показать все результаты (>9) - hcs.cmc.msu.ru/ )