... PyMol is a powerful drawing instrument and here we show how to plot Fukui function with PyMOL after two calculation steps with FireFly (PC-GAMESS). ... Because total HOMO orbital have two electrons and should be divided by two (see equations at the beginning). 1 комментарий " Building and plotting Fukui function with FireFly and PyMol " . Quantum chemistry information page ERG Research Group: Лаборатория теоретической биофизики написал (Май 20th, 2015 12:43 пп) . ... 2014 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>20) - erg.biophys.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>7) - storage.bioinf.fbb.msu.ru/ )

... Seasonal changes in microsomal fraction enriched with Na,K-ATPase from kidneys of the ground squirrel Spermophilus undulatus. ... The Na,K-ATPase activity in microsomal fraction isolated from kidneys of winter hibernating ground squirrels was found to be 1.8-2.0-fold lower than that in active animals in summer. ... We suggest that the decrease in Na,K-ATPase activity in kidneys of ground squirrels during hibernation is mainly connected with the aggregation of proteins in plasma membrane. ...

Еще в разделе: (Показать все результаты (>25) - biochem.bio.msu.ru/ )

• Low Concentrations of Hydrogen Peroxide Activate the Antioxidant Defense System

The 4th All-Russia conference "Radar-Location and Radio Communication" Dear colleagues! ... Information for authors and participants of conference is in Journal of Radio Electronics (JRE) http://jre.cplire.ru/jre/contents.html in th e section http://jre.cplire.ru/jre/4conf/index.htm. ... IV « » 29 - 3 .. « » http://jre.cplire.ru/jre/contents.html http://jre.cplire.ru/jre/4conf/index.ht m . http://jre.cplire.ru/jre/4conf/ members.htm Email: falcon@cplire.ru , rudolf@cplire.ru org4conf@cplire.ru . ...

Еще в разделе: (Показать все результаты (>49) - phys.msu.ru/ )

• http://phys.msu.su/upload/iblock/5ef/4conference.pdf
• http://phys.msu.su/upload/iblock/a95/1stcall.doc

... Юрий (admin) Новости архивы , психометрика , электронные журналы No Comments . ... Ноя 27 . ... Юрий (admin) Новости профессии , профориентация No Comments . ... Юрий (admin) Новости инфограмма , профессии , профориентация No Comments . ... Юрий (admin) Новости день психолога , о профессиях No Comments . ... Юрий (admin) Новости видео , научные конференции , экспериментальная психология , эксперименты No Comments . ... Юрий (admin) Новости заработок в интернете , платные опросы No Comments . ...

Еще в разделе: (Показать все результаты (>16) - tukachev.flogiston.ru/ )

• Statistics One, Lecture 3, example script

... Fast Facts about the Faculty of Journalism . ... Academic Departments . ... Partners . ... All partners . ... The Department of Television and Radio Broadcasting was established in 1958. The department was the first in the USSR and in Russia, where the theoretical foundations of television and radio broadcasting were studied and taught.љ ... Textbooks and monographs written by professors and lecturers of the department are widely used in Journalism Schools both in Russia and abroad. ...

Еще в разделе: (Показать все результаты (>26) - www.journ.msu.ru/ )

• A public talk of Professor Nico Carpentier :: Department of Journalism, M. V.
• International Media Management Academic Association's (IMMAA) Annual
• International Media Management Academic Association's (IMMAA) Annual Conference

IV чемпионат проекта 'Воздушно-инженерная школа (Cansat в России)'. Дубна и Талдомский р-н, 01.07.20 . С 29 июня по 4 июля 2015 года в г.Дубна (филиал НИИЯФ МГУ) и Талдомском районе Московской области будет проходить 4-й ежегодный чемпионат проекта 'СanSat в России'. ... Ссылка на предыдущие соревнования: http://www.msu.dubna.ru/main/index.php?option=com_content&task=view&id=77&Itemid=1 . ... Открытие в филиале НИИЯФ МГУ (Дубна, ул. Ленинградская д. 12), публичные . ...

Еще в разделе: (Показать все результаты (>12) - www.msu.dubna.ru/ )

ПРЕСС-РЕЛИЗ Объявлены результаты школы инновационного предпринимательства - 2010 Дубна, Московская область, 26 августа 2010 г. - Летняя школа-тренинг по инновационному предпринимательству, организованная при поддержке корпорации Intel, РОСНАНО и МГУ имени М.В.Ломоносова, завершилась конкурсом предпринимательских проектов. ... Около 10 тысяч школьников занимаются при МГУ. ... С 2006 года по 2010 год в особые экономические зоны России пришло 230 инвесторов из 18 стран, и этот процесс набирает обороты. ...

Еще в разделе: (Показать все результаты (>15) - www.msu.ru/ )

• http://www.msu.ru/science/details/2010/101021-moscow-wp2011.pdf
• http://www.msu.ru/science/details/2005/Competition_May2005.doc

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>96) - monkey.belozersky.msu.ru/ )

• About COGs
• Example of supporting positions
• SCOP famyli:

hpc@cmc . ... Blue Gene/P . ... На сайте NCCS.gov ( http://www.nccs.gov/2008/12/19/podcast-blue-genep-workshop-july-29-31-2008/ ) выложены видеоматериалы семинара, посвященного работе с Blue Gene/P: . Blue Gene/P Workshop Intro: http://www.nccs.gov/wp-content/podcasts/BGP08_intro.wmv . Blue Gene/P Architecture (Rajiv Bendale): http://www.nccs.gov/wp-content/podcasts/BGP08_Rajiv.wmv . ... Podcast: 2008 Blue Gene/P Workshop: http://www.nccs.gov/2008/12/29/podcast-2008-blue-genep-workshop/ . ...

Еще в разделе: (Показать все результаты (>3) - hpc.cmc.msu.ru/ )

... Parent Directory / . Directory . Chapter1.pdf . 2013-Feb-07 19:06:24 . ... application/pdf . Chapter2.pdf . ... Chapter3.pdf . ... 1.2M . ... Chapter4.pdf . ... Chapter5.pdf . ... Chapter6.pdf . ... Content.pdf . ...

Еще в разделе: (Показать все результаты (>12) - ocean.phys.msu.ru/ )

• Index of /courses/watercoursedyn/

... Basic Space Sciences in HighSchool and Cooperation in Space Education Pro jects 9 4 UNIVERSAT-2006 SCIENTIFIC PROGRAMME June 26, 2006, Monday 10:0013:00 Registration 13:0015:00 Lunch 15:0016:30 Opening Ceremony and Invited Reports INVITED REPORTS (30 min) 15:2015:50 Haubold, H.J., The United Nations Basic Space Science Initiative 15:5016:20 Krasotkin S.A., Panasyuk M.I., Radchenko V.V., Space research scientic and educational ... Chalova E.R., Aerospace images in school education 4. ...

Еще в разделе: (Показать все результаты (>24) - cosmos.msu.ru/ )

• University Satellites and Space Science Education '2006

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

194. Align tool for DNA-protein complexes

195. http://www.mse-msu.ru/Ayvazyan_Introduction_to_the_textbook_on_econometrics.pdf

196. Proceedings of the Fifth Russian-Japanese Symposium on Ferroelectricity

197. http://www.psy.msu.ru/science/psyrussia/2013/frolova.pdf

198. PARALLEL.RU - Новости, выпуск #267 [09/06/2009]

199. Власова Татьяна Анатольевна

200. http://beams.chem.msu.ru/doc/JAP2004_96_109.pdf