... A11, 1393, doi:10.1029/2001JA005073, 2002 Statistical distributions of field-aligned electron events in the near-equatorial magnetosphere observed by the Low Energy Plasma Analyzer on CRRES G. A. Abel,1 A. N. Fazakerley, and A. D. Johnstone2 Mullard Space Science Laboratory, University College London, Holmbury St. Mary, Dorking, Surrey, UK Received 27 August 2001; revised 26 April 2002; accepted 22 August 2002; published 22 November 2002. ... FIELD-ALIGNED ELECTRON EVENTS SMP 29 - 3 Figure 1. ...

Еще в разделе: (Показать все результаты (>111) - www.kosmofizika.ru/ )

• http://www.kosmofizika.ru/pdf2/e_p_apatity08.pdf
• http://www.kosmofizika.ru/pdf2/scl_open_e.doc
• http://www.kosmofizika.ru/pdf2/ga4_08_e.pdf

A.Nekipelov Modernization of Basic Research in Russia: Russian Academy of Sciences' (RAS) Vision Russia stands among the few countries of the world engaged in basic research along all its principal avenues. ... For example, in 2008 the total share of Candidates of Science engaged in Russian research organizations made 20.2% and that of Doctors of Science 6.7% whereas in RAS institutes the indicators were 43.0 and 19.0% respectively. ... The key link in basic research is a scientific laboratory. ...

Еще в разделе: (Показать все результаты (>28) - www.mse-msu.ru/ )

• http://www.mse-msu.ru/Russia_2010_MSE_en.pdf
• http://www.mse-msu.ru/files/k1205.pdf
• http://www.mse-msu.ru/Ayvazyan_Introduction_to_the_textbook_on_econometrics.pdf

... 23 2007 © The Japan Society for Analytical Chemistry 357 Application of Alkaline Phosphatases from Different Sources in Pharmaceutical and Clinical Analysis for the Determination of Their Cofactors; Zinc and Magnesium Ions Svetlana V. MUGINOVA, Anna M. Z Tatyana N. SHEKHOVTSOVA HAVORONKOVA, Alexei E. P OLYAKOV, and Chemistry Department, M. V. Lomonosov Moscow State University, Leninskie Gory, Moscow 119992 GSP-2, Russia Prospects of using different alkaline ...

Еще в разделе: (Показать все результаты (>31) - analyt.chem.msu.ru/ )

• http://analyt.chem.msu.ru/kinetics/papers/Mug%20Zhavoron%20Potentialities%20of%20Phosphatases%20ZhAKh%202005.pdf
• http://analyt.chem.msu.ru/kinetics/papers/Luchinina%20Galimova%20Ascorbic%20acid%20%20Anal.%20Chem%20Acta%202006.pdf
• http://analyt.chem.msu.ru/kinetics/papers/Inhibition%20of%20Horse%20Liver%20Alcohol%20Dehydrogenase%20Bychkov%20191-%202005.pdf

... This article caused a most lively interest from the readers, and received more than a hundred responses, which contained various versions of construction methods of the Sri Yantra. ... In this way he revealed a good correspondence between the concentric levels built by him in this relationship of the three Sri Yantra and the orbits of the planets of the solar system (Fig. 10, shows the first two out of three stars examined by him) with a divergence from the real diameters of orbits of about 1.5%. ...

Еще в разделе: (Показать все результаты (>16) - www.protein.bio.msu.ru/ )

• CONAN-m

МГУ имени М.В.Ломоносова Русская версия . ... Science calendar . ... Innovative natural resources management . ... Art Criticism and History . ... International Conference for Students and Young Scientists "Lomonosov" . ... 29 Feb 2016 . ... The members of C ouncil of experts : Bobyleva A.Z., Doctor of Economics, Professor; Volcov F.M., Doctor of Economics, Professor; Klementyev D.S., Doctor of Philosophy science, Professor; Koshkidko V . ... The history of management . ... МГУ имени М.В. Ломоносова . ...

Еще в разделе: (Показать все результаты (>53) - conf.msu.ru/ )

Supernova 1987A in LMC . One day in 1987, an astronomer by the name of Ian Shelton was making observations of the Tarantula Nebula in Large Magellanic cloud at Las Campanas Observatory, and he noticed something strange on his image. ... SN 1987A got as bright as 2.7, the only other recent SN even to come close was 1885A in M31 which got up to mag 6. ... Mag 4.5 . ... IAUC 4318 2/25/87 Type II? ... IAUC 7354 2/1/00 New structure in the inner ring . ... IAUC 7360 2/7/00 HST observation of new spot . ...

Еще в разделе: (Показать все результаты (>430) - www.rochesterastronomy.org/ )

• Supernova 2009js in NGC 918
• Supernova 2002fk in NGC 1309
• Supernova 2011dm in UGC 11861

... to Composite Mechanics Chair. was based at Mechanical & Mathematical Department in 1987. ... Address: Composite Mechanics Chair, Mechanical & Mathematical Department, Moscow State University, Moscow 119899, Russia. ... The Department of the Composites Mechanics was found at the Faculty of Mechanics and Mathematics of Lomonosov Moscow State University (MSU) in 1987. ... Optimisation of numerical methods in Solid Mechanics . Application of asymptotical methods in Composites Mechanics . ...

Еще в разделе: (Показать все результаты (>4) - composite.msu.ru/ )

• Pobedria Boris Efimovich

... Taxes and Taxpayers in Russia in the beginning of the 20th century, . ... Ezhegodnik (Economic Hystory. ... The article considers the Russian prewar tax system as an essential part of the government's general economic policy as well as an important factor of economic growth. ... In the beginning of the 20th century commercial and industrial taxes (tax on trade) amounted to half of the total of direct taxes, collected in Russia, in comparison with 20% at the end of the 19th century. ...

Еще в разделе: (Показать все результаты (>228) - hist.msu.ru/ )

• Department of Ethnology
• Toleration and Persecution. Christian Attitudes to Jews and Judaism in "Latin"
• "Novaya i noveishaia istoria" Journal

e-mail: inna_ver@rambler.ru) , , , , , , , society, Agent, System, Structure, Structuration, globalization, radical modern . The article is devoted to the analysis of the theory of structuration viewed as the basis for the work of A. Giddens, the British sociologist. ... The theory of structuration is interpreted as the basis for A. Giddens's analysis of modern society, the latter characterised by the British sociologist as radical modern. ...

Еще в разделе: (Показать все результаты (>89) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2011/4/07.pdf
• http://www.socio.msu.ru/vestnik/archive/2013/4/09.pdf
• http://www.socio.msu.ru/vestnik/archive/2012/3/13.pdf

Current Issue About us Editors Board of Editors Guidelines Contacts . ... 2015 . ... Developing the Russian health resorts is important in restoring and maintaining people s health. The author discusses the perspectives of resorts public health care system using the experience of a specialized allergology service in a Pyatigorsk resort as an example. ... Sanatorium-resort therapy, modern sanatorium, integrated medical care, health care management, quality control, bronchial asthma, allergy . ...

Еще в разделе: (Показать все результаты (>309) - ee-journal.spa.msu.ru/ )

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>8) - npidb.belozersky.msu.ru/ )

• NPIDB: 5DPK structure

... Unemployment of graduates combined with a shortage of highly educated young people is putting the European governments under pressure to act. ... The Bologna Declaration explicitly mentions the lack of competitiveness of European Higher Education institutions. The signatory countries actually explicitly express their goal to "ensure that the European higher education system acquires a world- wide degree of attractiveness equal to [Europe's] extraordinary cultural and scientific traditions". ...

Еще в разделе: (Показать все результаты (>2) - www.edst.msu.ru/ )

... Assume that gas is a thermodynamic system in the state of local equilibrium, that is, it is satisfied the relation [2] [pic] (1) There [pic],[pic] and [pic] are the temperature, the pressure and the gas volume, [pic], [pic] are entropy and internal energy per unit volume. ... Let us consider the first-degree form [pic]. ... Since the evolutionary relation is not identical, from this relation one cannot get the state differential [pic] that may point to the equilibrium state of the material system. ...

Еще в разделе: (Показать все результаты (>31) - hit-conf.imec.msu.ru/ )

• http://hit-conf.imec.msu.ru/books/NeZaTeGiUs_2010.pdf
• http://hit-conf.imec.msu.ru/2006/CD/BozhkoAAPutinGF.doc
• http://hit-conf.imec.msu.ru/2006/CD/BozhkoAAPutinGF.pdf

... Three representative parameters characterizing the solar activity are sunspot number (W), 10.7cm radio solar flux (F10.7) and mean solar magnetic field value (SF). ... Practically persistent time series of these parameters are appropriate data sets for modelling and forecasting by means of Artificial Neural Networks (ANN). Methods of optimization of ANN input data sets and selection of training, testing and examination sets are discussed in the paper. ...

Еще в разделе: (Показать все результаты (>24) - dbserv.sinp.msu.ru/ )

• 3d Map Description
• SW and GM conditions
• tunka_graph

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>170) - tukachev.flogiston.ru/ )

• Category: Новости

... The luminescence time dependence for two types of core/shell QDs (CdSe/CdS and CdTe/CdSe ) were investigated and were compared with behavior of naked ones (CdSe). ... Three different types of QDs were used in this work: simple core CdSe QDs, core/shell CdSe/CdS QDs and type II core/shell CdTe/CdSe heterostructures in charge carrier division regime (Fig.1). ... So core/shell nanocrystals demonstrate intermediate behavior between CdSe core-type QDs and CdTe/CdSe core/shell heterostructures. ...

Еще в разделе: (Показать все результаты (>51) - www.lssm.inorg.chem.msu.ru/ )

• The Laboratory of chemistry and physics of sensor and semiconductor materials
• The Laboratory of chemistry and physics of sensor and semiconductor materials |

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/batmas30.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/jbcb_2006.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/insilicobiol_2003.pdf

Exchanges Exchanges with Moscow University . ... Exchanges . ... Students studying at partner universities may come as exchange students to Moscow University according to conditions set up by exchange agreements. ... Formal nomination letter signed by head of international office of home university. This letter shoull arrive in original and by fax to +7 (495) 9328960 or as scanned copy to e-mail of a proper coordinator . Personal application , also as original and by fax/e-mail. ...

Еще в разделе: (Показать все результаты (>4) - www.ied.msu.ru/ )

SELECT data_key, data_value FROM xf_data_registry WHERE data_key IN ('options', 'languages', 'contentTypes', 'codeEventListeners', 'cron', 'simpleCache', 'routesPublic', 'bannedIps', 'styles', 'nodeTypes', 'smilies', 'bbCode', 'displayStyles', 'trophyUserTitles', 'reportCounts', 'moderationCounts') . ... Select Type . ... Ref . ... SIMPLE . ... PRIMARY . ... const . ... library/XenForo/ Autoloader.php . ... library/Zend/Registry.php . ... library/Zend/Config.php . ... library/Zend/Db/Select.php . ...

Еще в разделе: (Показать все результаты (>26) - osk.msu.ru/ )

• http://osk.msu.ru/forum/members/adollekautoto.2142/?_debug=1
• http://osk.msu.ru/forum/members/arbimeorirm.2192/?_debug=1
• http://osk.msu.ru/forum/members/catyfopwbex.2168/?_debug=1

... Study of the nature and magnitude of buffer capacity in various soils, information on mechanisms of buffer reactions is required to predict the rates of further acidification and to estimate the critical loads. ... The problem of estimation of soil sustainability to acid deposition is considered. ... The uncertainty in the estimated critical load values can be rather large due to uncertainty in critical chemical values for the soil as for a receptor, assessment method and data. ...

Еще в разделе: (Показать все результаты (>38) - eco.soil.msu.ru/ )

• Forest Soil Response to Acid Deposition
• CRITICAL LOADS OF ACID DEPOSITION IN EUROPEAN RUSSIA
• Norwegian-Russian cooperation in the border area