... Publications . ... SPDC Laboratory . Quantum Electronics Chair . ... Mathematical modeling of the accuracy characteristics in problems of precision quantum tomography of biphoton states?, ... A model that approximately takes into account instrumental errors in problems of precision reconstruction of quantum states is considered. ... Various sources of instrumental errors that affect the reconstruction accuracy of quantum states are mathematically modeled. ...

Еще в разделе: (Показать все результаты (>120) - qi.phys.msu.ru/ )

Information Security Meeting Schedule Thursday, March 30 12:00 noon Opening and Catered Lunch 1:00 R. Sekar, Stony Brook University - Ongoing Research at Secure Systems Laboratory at Stony Brook University 1:30 Scott Craver, Binghamton University - Information Hiding and Counterdeception 2:00 Sanjay Goel, University at ...

Еще в разделе: (Показать все результаты (>28) - suny.msu.ru/ )

• http://www.suny.msu.ru/en/CyberCon05En.doc
• http://suny.msu.ru/ru/ProgramMaBIT05En.doc

... On-line консультант . ... Место работы, должность: Преподаватель, старший научный сотрудник Лаборатории Вычислительных комплексов ВМК МГУ имени М.В.Ломоносова . ... D. Gamayunov, R. Smeliansky. ... 2002. (in Russian) . D. Gamayunov, A. Kachalin. ... In proceedings of the fifth Russian Applied and . ... detectors of computer attacks for corporate networks. ... I. Bulgakov, D. Gamayunov, E. Toroschin, Detecting network worms . ... Опыт работы по тематике магистратуры: 9 лет (руководство . ...

Еще в разделе: (Показать все результаты (>9) - erp.cmc.msu.ru/ )

... Journals . Memoirs of the Faculty of Physics . Moscow University Physics Bulletin . ... The conference papers from the School-Seminar ?Waves-2014? will be submitted for publishing in the Memoirs of the Faculty of Physics journal. ... Moscow University Physics Bulletin was founded in 1946 by Lomonosov Moscow State University and the Faculty of Physics. ... World-known physicists working at the Faculty of Physics (including 8 Nobel laureates) used to be and are the authors of the journal. ...

Еще в разделе: (Показать все результаты (>2) - vmu.phys.msu.ru/ )

... if (B1) { S1; } if (B1) { S1; } if (B2) { S2; } - - ...exp... int x = 1; if (x == 1) { std::cout << "Okay" << std::endl; } else { std::cout << "Error" << std::endl; } -- ­ int strlen(const char* p) { int len = 0; do { ++len; } while (*p++); return len; } «», «bbb» -- , : · ­ , , · ­ , , · ­ , · ­ . ... 1977 ­ LTL, · , 1981 ­ (CTL), · , , 1981 , , 1982 ­ model checking ( ), · , 1986 ­ model checking ( ), · , 1989 ­ SPIN. ... The Spin Model Checker: Primer and Reference Manual, Addison Wesley, 2003. ...

Еще в разделе: (Показать все результаты (>4) - savenkov.lvk.cs.msu.su/ )

Cell Biology International 27 (2003) 293­294 Cell Biology International www.elsevier.com/locate/jnlabr/ycbir Short communication Microtubule dynamics in living cells : direct analysis in the internal cytoplasm Ivan A. Vorobjev a a,* , Irina B. Alieva a, Ilya S. Grigoriev b, Gary G. Borisy c Laboratory of Cell Motility, A.N. Belozersky Institute, Moscow State University, Moscow, Russia b Department of ... These data demonstrate that MT growth is impeded at the cell margin. ...

Еще в разделе: (Показать все результаты (>35) - cellmotility.genebee.msu.ru/ )

• http://cellmotility.genebee.msu.ru/html/articles/amchencova98.pdf

... Выпускники . Выпускники ВМиК . ... Женский клуб . ... Издательство МГУ . ... Выпускники МГУ . ... Дайв-Клуб МГУ . ... Senior IFP Fall 2005 . The Center on Philanthropy and Civil Society's Senior International Fellows Program provides an opportunity for the professional development of Third-Sector practitioners from outside the United States who are decision makers in their professions. The program is designed to help build Third-Sector capacity in the Fellows' home countries. ...

Еще в разделе: (Показать все результаты (>1313) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: КИБЕРНЕТИЧЕСКАЯ ЛИЧНОСТЬ. БЕССМЕРТИЕ?
• Клуб выпускников МГУ: Scientists' Open Letter on Aging Research
• Клуб выпускников МГУ: Мгновения будущего: Главные изобретения и открытия -...

... Alexeyev V.L., Levich A.P. A search for maximum species abundances in ecological communities under conditional diversity optimization // Bull. of Mathemat. ... 1997. ... Bendoricchio G., JЬrgensen S.E. Exergy as a goal function of ecosystems dynamic // Ecological modelling. ... 1999. ... Comolli C.J., Donohue C., Timothy J. Pseudomonas aeruginosa RoxR, a response regulator related to Rhodobacter sphaeroides PrrA, activates expression of the cyanide- insensitive terminal oxidase. ... 1995. ... 2000. ...

Еще в разделе: (Показать все результаты (>18) - dis.bio.msu.ru/ )

• Математическое моделирование

... Submitted by Маруся_П on Wed, 03/09/2016 - 16:07 . The paperљ Optical tweezers study of red blood cell aggregation andљdisaggregationљin plasma and protein solutions љwritten by Maria D.љKhokhlova,љEvgenyљV.љLyubin,љAndreyљA.љFedyaninљin collaboration withљKisungљLee,љMattiљKinnunen, Alexander V.љPriezzhevљand IgorљMeglinskiљ has just been published online љinљ The Journal of Biomedical Optics . ... Maxim Shcherbakov presents the nanophotonics on the Set Up Lectorium: . ...

Еще в разделе: (Показать все результаты (>96) - nanolab.phys.msu.ru/ )

• Our paper has been published in Journal of Magnetism and Magnetic Materials |
• Our paper has been published in The Journal of Biomedical Optics | Laboratory
• sharipova's blog | Laboratory of Nanophotonics & Metamaterials

Psychology in Russia: State of the Art Volume 6, Issue 1, 2013 Russian Psychological Society Lomonosov Moscow State University editorial Since the publication of its first issue in 2008, Psychology in Russia: State of the Art had served as a flagship journal for the Russian Psychological Society and has played an important and unique role for the field of psychology in Russia. ... In Psychology in Russia: State of the Art we believe that healthy development consists of continuity and change. ...

Еще в разделе: (Показать все результаты (>238) - www.psy.msu.ru/ )

• Абдуллаева Мехирбан Махаметжановна
• Psychology in Russia: State of the Art, Vol. 1, 2008
• National Psychological Journal

... education . ... Functional Nanomaterials . ... Composite Nanomaterials Master?s Program . ... admission in January 2010 . ... MSU Faculty of Chemistry announces a new Master?s Program in Composite Nanomaterials, 510500 Chemistry. The program is under the aegis of MSU Nanotechnology Education and Research Center. ... The program is aimed mainly at graduates and young scientists, including Candidates of Science, in chemistry or physics (additional higher education.) ...

Еще в разделе: (Показать все результаты (>37) - nano.msu.ru/ )

• International School ?Computer simulation of advanced materials?, 16?21 July
• Registration for the International School ?Computer simulation of advanced
• Statutes of the MSU Nanotechnology Education and Research Center | MSU

... 2006, . ... 424-436 Rybakov A. A. at al -- MCE -- 2006, v. 2, p. 424-436 , , . ... Mathematical Models In Biology, Ecology And Chemistry ek ( e k *e j = k j ) (1). ek ( ), . ... Phys. --1989. Vol. ... Amitrano C., Berry R.S. Probability distributions of local Liapunov exponents for small clusters // Phys. Rev. Lett. ... Chaotic behavior of triatomic clusters // Phys. Rev. A. -- 1997. ... Yurtsever E. Angular-momentum-driven chaos in small clusters // Phys. Rev. A. -- 1998. ...

Еще в разделе: (Показать все результаты (>22) - beams.chem.msu.ru/ )

• Сотрудники - Ларин Александр Владимирович
• Публикации

... Т.А. Власова. ... T.A. Vlassova. ... Acta horticularae, 1994, 381, (Proc. of International Symposium on Natural Phenols in Plant Resistance, 13-17 Sept. ... In: Modern fungicides and antifungal compounds 11, Intercept LTD, Andover, U.K.,( Proc of 12th International Symposium, Castle of Reinhardsbrunn, Germany, May 24-29, 1998), P.242-245. ... In: Modern fungicides and antifungal compounds (14th International Symposium, Castle of Reinhardsbrunn/Friedrichroda, Germany, April 25-29, 2004, Abstracts). ...

Еще в разделе: (Показать все результаты (>23) - plantphys.bio.msu.ru/ )

• Чуб Владимир Викторович

... Сектор информатики и биофизики сложных систем . ... О секторе . ... Учебная работа сектора включает лекции, семинары, практические занятия по информатике и математическому моделированию в биологии, биофизике, экологии на всех 5-ти курсах обучения на кафедре биофизики. ... Диффузия и взаимодействие белков в биологических мембранах? консультанты Ризниченко Г.Ю. , Рубин А.Б. Рабочие семинары сектора информатики и биофизики сложных систем проходят по четвергам в 11:00 в аудитории 124 (компьютерный класс...

Еще в разделе: (Показать все результаты (>10) - www.biophys.msu.ru/ )

• Устинин Дмитрий Михайлович

Главная . ... Добро пожаловать в Московский государственный университет им. М.В.Ломоносова, не только первый российский университет, но и интеллектуальный, духовный, научный, культурный и образовательный центр российского общества. ... В добрый путь! ... старейший университет России, основанный 12 (25) января 1755 года, в день Св. Великомученицы Татианы указом Императрицы Елизаветы Петровны по предложению великого русского ученого Михаила Васильевича Ломоносова и графа Ивана Ивановича Шувалова. ...

Еще в разделе: (Показать все результаты (>187) - www.ied.msu.ru/ )

• International Office of Moscow University - Обратная связь
• International Office of Moscow University - Home

... Квантовая теория . ... Непертурбативная низкоэнергетическая физика адронов и лептонов (руководители - проф. К.А.Свешников, проф. А.Е.Дорохов). ... Методы квантовой теории поля в физике конденсированного состояния (руководители - с.н.с. О.В.Павловский, с.н.с. М.В.Улыбышев). Кафедра активно участвует в организации и проведении ежегодных международных семинаров по проблемам квантовой теории поля и теории гравитации в ИФВЭ - Протвино. ... Phys. Rev. D 85 (2012) 094022, arXiv: 1110.6059. ...

Еще в разделе: (Показать все результаты (>17) - hep.phys.msu.ru/ )

... Voronov, Vasiliy. Scalability and efficiency of parallel power grid simulations on massively-parallel platforms (submitted). ... 2009. ... Voronov, Vasiliy and Popova, Nina. ... Conference proceedings 2010. ... Abstract Book of SIAM Conference on Parallel Processing for Scientific Computing (SIAM PP10). ... Proceedings of the International Conference on Parallel Computing (ParCo-2009). ... IEEE Computer Press. ... Pozdneev, Alexander and Popova, Nina and Voronov, Vasiliy. ...

Еще в разделе: (Показать все результаты (>5) - angel.cmc.msu.ru/ )

... Director of the Institute of World Culture . Member of Russian Academy of Sciences . ... Moscow State Lomonosov University (MGU); Institute of Slavic Studies of the Russian Academy of Sciences; Russian State Humanities University (RGGU); University of California, Los Angeles (UCLA), Department of Slavic Languages and Literatures and Indo-European Studies Program. ... Director of the Research Institute of World Culture of the Moscow Lomonosov State University (MGU), 1989-present. ...

Еще в разделе: (Показать все результаты (>25) - imk.msu.ru/ )

... Doronina L. , Volodin I., Volodina E. The arousal-related shifts in call characteristics of the defeated great gerbils Rhombomys opimus // 6th International Zoo and Wildlife Research Conference on Behaviour, Physiology and Genetics, Berlin, IZW, 2007, p. 77. ... Sibling aggression in lynx: traits and consequences // Advances in Ethology 38, Supplements to Ethology. ... Advances in Ethology, Contributions to the 5-th International Symposium on Physiology, Behaviour and Conservation of Wildlife. ...

Еще в разделе: (Показать все результаты (>86) - vertebrata.bio.msu.ru/ )

• А.В.Кленова
• Anna V.Klenova
• Выступления студентов и аспирантов на конференциях

Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...

Еще в разделе: (Показать все результаты (>6958) - mouse.belozersky.msu.ru/ )

• Index of /npidb/pdb
• wLake program homepage