... Font: Times New Roman . ... size - А4 (21 cm х 29,7 cm) . ... Title should be typed in capital letters, Times New Roman, size 13, boldface font; formatting: center. ... The title and the number of the table should be center-formatted (Times New Roman, size 11, single-spaced, no period/full stop at the end of the title). ... The title under the illustration should be center-formatted (Times New Roman, size 11, single-spaced, no period/full stop at the end of the title). ... Use Times New Roman size...

Еще в разделе: (Показать все результаты (>60) - www.spa.msu.ru/ )

... Minimal size of Clud clusters (residues) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Hydrophobic cluster of a single protein structure is a separated pool of nonpolar atoms. Usually there is the biggest cluster in the protein called hydrophobic core. ... ConClus program is able to detect of conservative hydrophobic clusters for a family of related protein domains or just for a set of aligned proteins. ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

The laboratory runs currently several scientific projects aimed at the foundations of quantum information science (the theories of quantum measurement and entanglement, design and analysis of quantum cryptographic protocols, atoms dynamics in optical dipole trap, etc.), applications of quantum theory to modeling quantum interference phenomena in multilevel atoms interacting with optical and magnetic fields (dark resonance spectroscopy), and exploring ... Physics 96 (4), 629-642 (2003). ...

Еще в разделе: (Показать все результаты (>71) - qilab.phys.msu.ru/ )

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>66) - monkey.belozersky.msu.ru/ )

• About COGs
• Example of supporting positions
• SDPpred

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>7) - storage.bioinf.fbb.msu.ru/ )

... Ярмарка вакансий и стажировок для студентов и выпускников вузов . Новости науки и техники События . ... Подписаться на новости . ... Computer Science . ... Software engineering for mobile devices . ... Design and development of middleware (collaboration system, context-aware system, content system) on mobile devices . Design and development of applications on mobile devices . ... 2) Embedded OS porting, system programming, Mobile OS . ... 5) Location-based service on mobile devices . ...

Еще в разделе: (Показать все результаты (>34) - www.physcareer.ru/ )

• Software Engineer (Server) / Вакансии / Physcareer.ru
• Software Engineer (Backend Servers / Web / WAP / Вакансии / Physcareer.ru
• Software Engineer (C/C++ and JAVA) / Вакансии / Physcareer.ru

... 4; mso-font-charset:204; mso-generic-font-family:swiss; mso-font-pitch:variable; mso-font-signature:536871559 0 0 0 415 0;} /* Style Definitions */ p.MsoNormal, li.MsoNormal, div.MsoNormal {mso- style -parent: ; margin:0cm; margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:12.0pt; font-family: Times New ...

Еще в разделе: (Показать все результаты (>70) - sai.msu.ru/ )

• http://www.sai.msu.ru/internal/library/ieee_tutorial.doc
• А С Т Р О К У Р Ь Е Р

... Paradigm shifts by Kuhn: successive change of one model by another, rather than integration of different paradigms Progress of science: from single- to multi-model approach Some examples from natural science... · theory of light: from vibration of ether to wave-particle duality · laws of motion: from Newton's dynamics to SchrЖdinger 's and Heisenberg's formalism In social and environmental sciences appreciation of the multi-model ...

Еще в разделе: (Показать все результаты (>2) - oc.cs.msu.ru/ )

... Seasonal changes in microsomal fraction enriched with Na,K-ATPase from kidneys of the ground squirrel Spermophilus undulatus. ... The Na,K-ATPase activity in microsomal fraction isolated from kidneys of winter hibernating ground squirrels was found to be 1.8-2.0-fold lower than that in active animals in summer. ... We suggest that the decrease in Na,K-ATPase activity in kidneys of ground squirrels during hibernation is mainly connected with the aggregation of proteins in plasma membrane. ...

Еще в разделе: (Показать все результаты (>21) - biochem.bio.msu.ru/ )

• Low Concentrations of Hydrogen Peroxide Activate the Antioxidant Defense System

The 4th All-Russia conference "Radar-Location and Radio Communication" Dear colleagues! ... Information for authors and participants of conference is in Journal of Radio Electronics (JRE) http://jre.cplire.ru/jre/contents.html in th e section http://jre.cplire.ru/jre/4conf/index.htm. ... IV « » 29 - 3 .. « » http://jre.cplire.ru/jre/contents.html http://jre.cplire.ru/jre/4conf/index.ht m . http://jre.cplire.ru/jre/4conf/ members.htm Email: falcon@cplire.ru , rudolf@cplire.ru org4conf@cplire.ru . ...

Еще в разделе: (Показать все результаты (>50) - phys.msu.ru/ )

• http://phys.msu.su/upload/iblock/5ef/4conference.pdf
• http://phys.msu.su/upload/iblock/a95/1stcall.doc

... Юрий (admin) Новости архивы , психометрика , электронные журналы No Comments . ... Ноя 27 . ... Юрий (admin) Новости профессии , профориентация No Comments . ... Юрий (admin) Новости инфограмма , профессии , профориентация No Comments . ... Юрий (admin) Новости день психолога , о профессиях No Comments . ... Юрий (admin) Новости видео , научные конференции , экспериментальная психология , эксперименты No Comments . ... Юрий (admin) Новости заработок в интернете , платные опросы No Comments . ...

Еще в разделе: (Показать все результаты (>15) - tukachev.flogiston.ru/ )

• Statistics One, Lecture 3, example script

... Fast Facts about the Faculty of Journalism . ... Academic Departments . ... Partners . ... All partners . ... The Department of Television and Radio Broadcasting was established in 1958. The department was the first in the USSR and in Russia, where the theoretical foundations of television and radio broadcasting were studied and taught.љ ... Textbooks and monographs written by professors and lecturers of the department are widely used in Journalism Schools both in Russia and abroad. ...

Еще в разделе: (Показать все результаты (>29) - www.journ.msu.ru/ )

• A public talk of Professor Nico Carpentier :: Department of Journalism, M. V.
• International Media Management Academic Association's (IMMAA) Annual
• International Media Management Academic Association's (IMMAA) Annual Conference

IV чемпионат проекта 'Воздушно-инженерная школа (Cansat в России)'. Дубна и Талдомский р-н, 01.07.20 . С 29 июня по 4 июля 2015 года в г.Дубна (филиал НИИЯФ МГУ) и Талдомском районе Московской области будет проходить 4-й ежегодный чемпионат проекта 'СanSat в России'. ... Ссылка на предыдущие соревнования: http://www.msu.dubna.ru/main/index.php?option=com_content&task=view&id=77&Itemid=1 . ... Открытие в филиале НИИЯФ МГУ (Дубна, ул. Ленинградская д. 12), публичные . ...

Еще в разделе: (Показать все результаты (>12) - www.msu.dubna.ru/ )

Sergey A. Ayvazyan Methods of Econometrics Introduction Dear reader, You have a textbook in your hands on methods of econometrics, one of the three basic disciplines of higher economic learning, along with micro- and macroeconomics. In Russia, unfortunately, the status of econometrics was recognized belatedly: econometrics was introduced into the study programs of economic learning in several leading Russian higher educational institutions only since 1992. ...

Еще в разделе: (Показать все результаты (>13) - www.mse-msu.ru/ )

Psychology in Russia: State of the Art Volume 6, Issue 1, 2013 Russian Psychological Society Lomonosov Moscow State University Psychological aspects of the content strategies of the Russian media Tatiana I. Frolova Lomonosov Moscow State University, Moscow, Russia This article looks at the content strategies of the Russian media and discusses whether they conform to humanitarian values. ... The social consequences of this media alienation from personal problems in the 1990s turned out to be dramatic. ...

Еще в разделе: (Показать все результаты (>126) - www.psy.msu.ru/ )

• http://www.psy.msu.ru/science/psyrussia/2012/strelkov.pdf
• http://www.psy.msu.ru/science/psyrussia/2012/karpov.pdf
• http://www.psy.msu.ru/science/psyrussia/2012/verbitsky.pdf

ПРЕСС-РЕЛИЗ Объявлены результаты школы инновационного предпринимательства - 2010 Дубна, Московская область, 26 августа 2010 г. - Летняя школа-тренинг по инновационному предпринимательству, организованная при поддержке корпорации Intel, РОСНАНО и МГУ имени М.В.Ломоносова, завершилась конкурсом предпринимательских проектов. ... Около 10 тысяч школьников занимаются при МГУ. ... С 2006 года по 2010 год в особые экономические зоны России пришло 230 инвесторов из 18 стран, и этот процесс набирает обороты. ...

Еще в разделе: (Показать все результаты (>31) - www.msu.ru/ )

• http://www.msu.ru/science/details/2010/101021-moscow-wp2011.pdf
• http://www.msu.ru/science/details/2005/Competition_May2005.doc

Electronic Proposal Submission Service - EPSS preparation and submission guide - Release Date: 5 May 2008 Table of Contents 1 1 .1 . ... Using PIC in EPSS.. ... 29 EPSS help desk Phone: +32 2 23 33 760 Email: support@epss-fp7.org EPSS User Manual Released on 5 May 2008 page 2 of 29 1 EPSS Preparation ­User's Guide The EPSS (Electronic Proposal Submission Service) allows Proposers to create their proposal completely on-line without downloading or saving anything on their local personal computer. ...

Еще в разделе: (Показать все результаты (>24) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/press_release_2012.doc
• http://ideas.msu.ru/docs/CSA_guide_2008.pdf

... X-Com key features (2) · Lightweight portable toolkit: ­ easy to install · Perl-based software · doesn't need administrator/root access ... must be written ­ simultaneous work of different platforms · joining Windows and Linux machines ­ distributed freely · BSD license X-Com basic requirements · Linux / Windows · Perl 5.8.0+ ­ for Windows: · Strawberry Perl (preferred) · ActivePerl · Open TCP port for Task initializing on server side Server part of the application 2. ... Portion request 6. ...

Еще в разделе: (Показать все результаты (>26) - hpc.msu.ru/ )

• http://hpc.msu.ru/files/HPC/X-Com_tutorial.pdf
• APPLICATIONS: Inorganic Chemistry | Moscow University Supercomputing Center

hpc@cmc . ... Blue Gene/P . ... На сайте NCCS.gov ( http://www.nccs.gov/2008/12/19/podcast-blue-genep-workshop-july-29-31-2008/ ) выложены видеоматериалы семинара, посвященного работе с Blue Gene/P: . Blue Gene/P Workshop Intro: http://www.nccs.gov/wp-content/podcasts/BGP08_intro.wmv . Blue Gene/P Architecture (Rajiv Bendale): http://www.nccs.gov/wp-content/podcasts/BGP08_Rajiv.wmv . ... Podcast: 2008 Blue Gene/P Workshop: http://www.nccs.gov/2008/12/29/podcast-2008-blue-genep-workshop/ . ...

200. Index of /courses/stathyd/book by Nosov/