Next: Activation Modes Up: Implementation Repository Previous: Forcing Activation of an . Assume we want to register the account server account_server2 from section 3.3.3 as a shared server. ... Recall that this server implemented the interface Account whose repository id is IDL:Account:1.0 . ... imr create Account shared /usr/bin/account_server2 IDL:Account:1.0 . ... imr create Account shared "rsh diamant /usr/bin/account_server2" \ IDL:Account:1.0 . ... account_client2.cc .. ...

Еще в разделе: (Показать все результаты (>390) - rtm-cs.sinp.msu.ru/ )

• Footnotes
• Activation Mode Shared
• Activation Mode Library

. Shell procedures may use the trap command to catch or ignore Unix operating system signals . The form of the trap command is: trap ' command-list ' signal-list . Several traps may be in effect at the same time. If multiple signals are received simultaneously, they are serviced in ascending order. To check what traps are currently set use the trap command. For example: trap . Most common signals to be caught . Handling command lists . Examples .

Еще в разделе: (Показать все результаты (>542) - comet.sai.msu.ru/ )

• Example of logging in to another account
• Example of switching to another account
• More about the UNIX operating system

Modules | ... Apache HTTP Server Version 2.0 . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... If you link it into your server, enable the "example-handler" handler for a location, and then browse to that location, you will see a display of some of the tracing the example module did as the various callbacks were made. ... Using the mod_example Module . ...

Еще в разделе: (Показать все результаты (>517) - itpm.msu.su/ )

• SLIP Operation
• Definitions and Conventions
• Background

... Of course, you need to have iwconfig installled on your system. ... matching is done on the first 3 bytes of the MAC address # SMC2835W EZ Connect g 2.4GHz 54 Mbps Wireless Cardbus Adapter 00:04:E2:*) INFO = SMC2835W EZ Connect g 2.4GHz 54 Mbps Wireless Cardbus Adapter # ESSID (extended network name) : My Network, any ESSID = any # NWID/Domain (cell identifier) : 89AB, 100, off NWID= # Operation mode : Ad-Hoc, Managed, Master, Repeater, Secondary, auto MODE = Managed # Frequency or ...

Еще в разделе: (Показать все результаты (>22048) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc617.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc617.txt
• http://mirror.msu.net/pub/gentoo-portage/sci-libs/openfoam/openfoam-2.3.1-r1.ebuild

Электронная библиотека Попечительского совета . ... Tanenbaum A.S.S. - Operating Systems: Design And Implementation . ... Название: Operating Systems: Design And Implementation . Автор: Tanenbaum A.S.S. Аннотация: . Most books on operating systems deal with theory while ignoring practice. ... Operating Systems: Design and Implementation Second Edition provides the MINIX source code. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>12266) - lib.mexmat.ru/ )

• Chu P.P. - FPGA Prototyping by Verilog Examples :: Электронная библиотека
• Gogolla M. - An Extended Entity-Relationship Model - Fundamentals and
• Rhodes D., Butler D. - Solaris Operating Environment Boot Camp :: Электронная

... 15,45 * * * * (cd ~twiki/public_html/bin; ./mailnotify -q) . ... This will generate log entries in file twiki/data/log<date>.txt . ... The WebStatistics topic must be present in all webs where you want to have statistics. ... Call the twiki/bin/statistics script from a cron job, once a day is recommended. ... There is a workaround in case you can't run the script as user nobody : Run the utility twiki/bin/geturl in your cron job and specify the URL of the twiki/bin/statistics script as a parameter. ...

Еще в разделе: (Показать все результаты (>41610) - dualopt1.cmm.msu.ru/ )

• RegularExpression - TWiki - TWiki - (printable)
• %TOPICTITLE% (20 vs. 21) - TWiki

... Apache uses environment variables in many ways to control operations and to communicate with other programs like CGI scripts. ... mod_setenvif . ... Related Directives . BrowserMatch . ... SetEnvIf . ... The most basic way to set an environment variable in Apache is using the unconditional SetEnv directive. ... For additional flexibility, the directives provided by mod_setenvif allow environment variables to be set on a per-request basis, conditional on characteristics of particular requests. ...

Еще в разделе: (Показать все результаты (>942) - oit.cmc.msu.ru/ )

• php_uname
• yp_err_string
• ircg_fetch_error_msg

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>103) - neptun.sai.msu.ru/ )

• Apache module mod_auth
• Apache module mod_so
• Environment Variables in Apache

... Class . ... Provides an abstraction for multidimensional array access, some concrete implementations, and ways to view a MultiArray as if it had a different structure. ... This interface defines the services required by MultiArrayProxy to manipulate indexes and the dimensions of a MultiArray. ... In the following, we use the unadorned term "array" to mean the Java language construct, and the term "multidimensional array" for the mathematical abstraction modeled by the MultiArray class in this...

Еще в разделе: (Показать все результаты (>54) - angel.cs.msu.su/ )

• ExtensionFileFilter

... About Trac . ... wiki: WikiRestructuredText . ... Trac supports using reStructuredText (RST) as an alternative to wiki markup in any context WikiFormatting is used. ... See тАЛ this example . ... A table: ===== ===== ====== Inputs Output ------------ ------ A B A or B ===== ===== ====== False False False True False True False True True True True True ===== ===== ====== RST TracLinks ------------- See also ticket `#42`:trac:.. _webpage: http://docutils.sourceforge.net/rst.html }}} . ... False . ...

Еще в разделе: (Показать все результаты (>1496) - kodomo.cmm.msu.ru/ )

• TracWorkflow тАУ Tanchiki
• example.snake in snakes тАУ Python Battle

Either several (at least two) Intel/AMD-based computers having identical or similar hardware configuration and running in the local network environment under the control of Windows NT 4.0, Windows 2000, Windows XP, Windows Server 2003, Windows Vista, Windows Server 2008, or Windows 7. ... The 32-bit NT-MPICH package (the part of MP-MPICH) must be installed, including MPI dynamic link libraries and cluster management service, on all computers to be used to run PC GAMESS/Firefly in parallel. ...

Еще в разделе: (Показать все результаты (>85) - classic.chem.msu.su/ )

• PC GAMESS/Firefly DOCUMENTATION - running in parallel using LAM/MPI
• PC GAMESS/Firefly DOCUMENTATION - running in parallel under Windows using WMPI
• PC GAMESS/Firefly DOCUMENTATION - running in parallel Linux/MPICH binaries

... Structure of Data . ... Catalog . ... The SAI OCL Catalog site provides several VO-enabled modes of operation: . VO-enabled catalog data analysis from a browser . ... Endpoint URL is http://ocl.sai.msu.ru/catalog/conesearch/ . ... VO-enabled catalog analysis from a browser . Presently, this recipe works with Firefox (Windows, MacOS, Linux), Internet Explorer (Windows) and Opera (Windows) browsers with Java plugin 1.6 installed. ... Main TOPCAT window with SAI OCL catalog loaded will appear. ...

Еще в разделе: (Показать все результаты (>2) - ocl.sai.msu.ru/ )

... Software . Laboratory of Mathematical Methods of Image Processing . ... Available options: -sigma - (mandatory) set blur parameter for the input image , range: 1.0 to 20.0 - power - set warping power , range: 0.0 to 5.0, default value is 1.0 -1d - apply one-dimensional algorithm (faster but lower quality) basicedges - detect basic edges - edges good for artifact analysis -scale - set scale parameter, range: 1.0 to 20.0, default value is 4.0 gaussblur - blur input ... warp.png . ...

Еще в разделе: (Показать все результаты (>90) - imaging.cmc.msu.ru/ )

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>55) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

... In this first example, we allow an object to fall onto a small radar unit . The resulting Time-Frequency distribution is shown as a contour plot in Fig. 8 (a). Figure: FIGURE GOES SOMEWHERE IN THIS GENERAL VICINITY . ... Its density plot appears as an image in Fig. ... The response has a very high peak, as evidenced from Fig. ...

Еще в разделе: (Показать все результаты (>2163) - crydee.sai.msu.ru/ )

• Long description for example showing how structurally overlapping cells are
• One example
• Image: Interesting example of building wall. No windows. Hmmm...

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>17) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... Tessman A. B., Ivanov A. V. The "Acid-Base Calculator" Programm for Simulation of the Acid-Base Equilibria in Aqueous Solutions . Abstract The computer programm "Acid-Base Calculator" for simulation of pH and ionic strength values of mixtures of salts, strong and weak acid and bases in aqueous media are suggested. ... Moscow University Chemistry Bulletin . 2001, Vol. ... Copyright (C) Chemistry Dept., ... Copyright (C) Chemisty Department of Moscow State University . ...

Еще в разделе: (Показать все результаты (>460) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 45, No. 1, P. 38 (2004)
• Moscow University Chemistry Bulletin Vol. 50, No. 5, P. 297 (2009)
• Entrance Examinations - Main Round

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>135) - bioinf.fbb.msu.ru/ )

• Input Formats
• Alignment example
• User's guide

Implementation of vectorized finite-difference algorithms for solving boundary value problems of fluid and gas mechanics with MATLAB package" . Volkov K.N., Emelyanov V.N. An approach to organization of vectorized computations and implementation of finite-difference methods for solving boundary value problems of fluid and gas mechanics with MATLAB package is considered. ...

Еще в разделе: (Показать все результаты (>284) - num-meth.srcc.msu.ru/ )

• Using Intel Xeon Phi coprocessors for execution of natural join on compressed
• "Bayesian network prediction: algorithm and software implementation"
• "A general approach to the implementation of methods for the implicit surface

. Name . Last modified . Size . Description . Parent Directory . - . alpha/ . 2007-02-10 22:19 . - . alpha_and_beta/ . 2007-02-10 22:19 . - . beta/ . 2007-02-10 22:19 . - . Apache/2.4.12 (Debian) Server at kodomo.fbb.msu.ru Port 80

Еще в разделе: (Показать все результаты (>10981) - kodomo.fbb.msu.ru/ )

• allpy: 3a712982ceb8 debian/changelog
• snake: 954cc2774637 snakes/example.snake
• allpy: 3a712982ceb8 README.devel