PHP Manual . ... This function is EXPERIMENTAL . ... Really! function text($r, $g, $b, $a, $ rot , $x, $y, $ scale , $string) { global $f, $m; $t = new SWFText(); $t- setFont($f); $t- setColor($r, $g, $b, $a); $t- setHeight(960); $t- ... ;moveTo(-($f- getWidth($string))/2, $f- getAscent()/2); $t- addString($string); // we can add properties just like a normal php var, // as long as the names aren't already used. // e.g., we can't set $i- scale , because that's a ... SWFDisplayItem->scale . ...

Еще в разделе: (Показать все результаты (>1583) - oit.cmc.msu.ru/ )

... A hybrid heuristic parallel method of global optimization" . ... A hybrid heuristic parallel method for solving of complicated global optimization problems is proposed. ... The method is compared with 21 modern methods of global optimization and with a genetic algorithm using 28 test objective functions of 50 variables. Keywords: global optimization, heuristic methods, neural networks, parallel computing, C++, MPI. ...

Еще в разделе: (Показать все результаты (>225) - num-meth.srcc.msu.ru/ )

• "Parallel constrained global optimization for mathematical modeling of chemical
• "Numerical aspects of the calculation of scaling factors from experimental...

... It is extended to improve the display of hierarchical web structures, a feature added to TWiki4 and adds more flexibility when used in TWikiApplications. ... This tag iterates over all specified webs and all of their subwebs recursively while using the specified format strings to produce the output. ... subfooter : format string following the output of any subweb; subheader and subfooter are only added if the list of subwebs of the current web is not empty (defaults to footer ) . ... format . ...

Еще в разделе: (Показать все результаты (>40500) - dualopt1.cmm.msu.ru/ )

• SlideShowPlugin - TWiki - TWiki - (printable)
• %TOPICTITLE% (3 vs. 4) - TWiki

. To run the previous command: pwd /u/user/eucs/joe r pwd /u/user/eucs/joe . To re-run a command from the history list: r 15 . This re-runs command number fifteen from the history list. To re-run the most recent command that starts with a particular string: r grep grep -n '[dD]on't' tasks \ less . This re-runs the most recent command that starts with the string grep .

Еще в разделе: (Показать все результаты (>522) - comet.sai.msu.ru/ )

• Examples of using the grep command
• Examples of runnning a command from the history list
• Example of using the break and continue statements

diff -Naur image-0.2.7.26.orig/ examples /imagecmds.conf image-0.2.7.26/ examples /imagecmds.conf --- image-0.2.7.26.orig/ examples /imagecmds.conf 2008-10-25 23:48:18.000000000 + 0200 +++ image-0.2.7.26/ examples /imagecmds.conf 2008-10-25 23:50:53.000000000 + 0200 @@ -20,3 +20,5 @@ Rotate JPEG picture lossless by 90 degrees to the right : jpegtran - rotate 90 %s $ CONVERT_TEMPDIR / tmp.jpg mv $ ...

Еще в разделе: (Показать все результаты (>20159) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/internet-drafts/draft-chen-netmod-enterprise-yang-namespace-00.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/bcp/bcp32.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc2606.txt.pdf

. This diagram illustrates how text shadow may be used to create an "eclipse effect." . The string "ECLIPSE" is shown in white uppercase letters. Each letter has a gray surrounding shadow extending on all sides of the letter stems. Return to image.

Еще в разделе: (Показать все результаты (>1926) - crydee.sai.msu.ru/ )

• Dynamic HTML in Communicator
• Long description for example of clipping region
• Long description of example illustrating the collapsing borders model

previous next contents elements attributes . ... Definitions . ... User agent . A user agent is any device that interprets HTML documents. ... User agents should continue to support deprecated elements for reasons of backward compatibility. ... An obsolete element or attribute is one for which there is no guarantee of support by a user agent. ... Element and attribute names are marked within the source HTML for the specification and may be rendered specially depending on your user agent. ...

Еще в разделе: (Показать все результаты (>485) - itpm.msu.su/ )

• perchild - Apache HTTP Server
• rotatelogs - Piped logging program to rotate Apache logs - Apache HTTP Server
• Global elm Options

... help . find changesets by author, revision, files, or words in the commit message Template Usage Mercurial allows you to customize output of commands through templates. ... Usage: $ hg log -r1 --style changelog A template is a piece of text, with markup to invoke variable expansion: $ hg log -r1 --template "{node}\n" b56ce7b07c52de7d5fd79fb89701ea538af65746 Strings in curly braces are called keywords. ... The changeset bisection status. bookmarks List of strings. ...

Еще в разделе: (Показать все результаты (>3071) - kodomo.cmm.msu.ru/ )

• TracEnvironment тАУ Tanchiki
• example.snake in snakes тАУ Python Battle
• WikiProcessors тАУ Tanchiki

... help . find changesets by author, revision, files, or words in the commit message Template Usage Mercurial allows you to customize output of commands through templates. ... Usage: $ hg log -r1 --style changelog A template is a piece of text, with markup to invoke variable expansion: $ hg log -r1 --template "{node}\n" b56ce7b07c52de7d5fd79fb89701ea538af65746 Strings in curly braces are called keywords. ... The changeset bisection status. bookmarks List of strings. ...

Еще в разделе: (Показать все результаты (>22053) - kodomo.fbb.msu.ru/ )

• allpy: ca2cf2377bed allpy/util.py
• allpy: b520e79fd1f4 allpy/util.py
• allpy: 7194066a3621 allpy/util.py

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>17) - mouse.genebee.msu.ru/ )

• ConClus
• Align tool for DNA-protein complexes

... Mejlbro L. - Calculus 2c-10, Examples of Nabla Calculus, Vector Potentials, Green's Identities and Curvilinear Coordinates, Electromagnetism and Various other Types . ... Название: Calculus 2c-10, Examples of Nabla Calculus, Vector Potentials, Green's Identities and Curvilinear Coordinates, Electromagnetism and Various other Types . Автор: Mejlbro L. Язык: . ...

Еще в разделе: (Показать все результаты (>13221) - lib.mexmat.ru/ )

• Walser H., Pedersen J. - 99 Points of Intersection: Examples, Pictures, Proofs
• Seul M., O'Gorman L., Sammon M.J. - Practical algorithms for image analysis.
• Vincent K.C. - Fundamentals of Composite Materials :: Электронная библиотека

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>105) - neptun.sai.msu.ru/ )

• Apache module mod_vhost_alias
• Apache module mod_imap
• Apache module mod_alias

... Introduction As is well known, according to Special Relativity (SR) a transition from an immovable reference system to any moving one may by interpreted as some rotation in the Minkowski space. ... In fact, when we come from an immovable reference system to any moving one, the tme axis turns on the angle depending on velocity, and the light world line must stay the bisectrix. ... Besides, the new distances along the new time axis between light cones will not equal to the old ones. ...

Еще в разделе: (Показать все результаты (>440) - chronos.msu.ru/ )

• Джунушалиев В. (Dzhunushaliev V.)
• Laboratory-chair of Discrete mechanics on a microscopic scale

... In studies such as those of Dziewonski [1984 ], Woodhouse and Dziewonski [1984 ] or Tanimoto [1990 ] it was assumed a priori that the lateral variations in the structure could be represented by a spherical harmonic expansion truncated at some low degree such as 6 or 8. ... A very similar spectrum (up do degree 8) is obtained by predicting the SS data from 3-D models such as an upper mantle model M84C [ Woodhouse and Dziewonski, 1984 ]. ... U.S. National Report to IUGG, 1991-1994 . ...

Еще в разделе: (Показать все результаты (>395) - geo.web.ru/ )

... public class ExtensionFileFilter . ... A convenience implementation of FileFilter that filters out all files except for those type extensions that it knows about. ... Extension - create a new filter that filerts out all files but gif and jpg image files: JFileChooser chooser = new JFileChooser(); ExtensionFileFilter filter = new ExtensionFileFilter( new String{"gif", "jpg"}, "JPEG GIF Images") chooser.addChoosableFileFilter(filter); chooser.showOpenDialog(this); . ... private java.lang.String . ...

Еще в разделе: (Показать все результаты (>145) - angel.cs.msu.su/ )

• Index
• Appendix B File Format Specification
• Appendix A Units

... Run program . User's guide . Launching program . Input data format . ... Selecting the number of correlated pairs . ... In order to run thr program one needs Java 5.0 environment. ... At the end of computations one will be asked to review the selected number of correlated pairs. ... Note: One may redefine the number of correlated pairs by selecting the 'Edit' -> 'redefine correlated pairs number' menu item. Correlated pairs of positions are presented as a colored matrix, the heatmap. ...

Еще в разделе: (Показать все результаты (>135) - bioinf.fbb.msu.ru/ )

• SDPsite - Gallery of examples
• Alignment example

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>72) - geophys.geol.msu.ru/ )

• TES. Field example.
• Anis. Page2
• TES tecnology. MSU.

Described below are two methods for preparing input files with basis sets and ECPs which are not currently built in. ... Put basis sets and ECPs in directories (called here def2_svp_BAS and def2_ecp_ECP but you can call them whatever you want) and copy them to the Firefly directory. ... Both methods can also be used for preparing gamess (us) files - the check runs may not terminate properly due to certain keywords, but a useable file called 'input' is normally generated. ...

Еще в разделе: (Показать все результаты (>98) - classic.chem.msu.su/ )

• Potential Energy Surfaces with PC GAMESS/Firefly
• PC GAMESS/Firefly DOCUMENTATION - running in parallel under Windows using WMPI
• PC GAMESS/Firefly DOCUMENTATION - running in parallel using LAM/MPI

Complexification as alternative to higher dimensions: N = 2 string as a complex source of Kerr geometry. ... Based on: A.B., Stringlike structures in the Kerr-Schild geometry: N=2 string, twistors and Calabi-Yau twofold [arXiv:1307.5021 ]. ... Complex shift of the Coulomb solution (x) in Cartesian coordinates x = (x, y , z ) Ta(x) = a(x + i~), where ~ = (0, 0, -ia), creates in the real slice Appel solution a = Re ~ ~a a in oblate spheroidal coordinates r and . ... Complex Kerr String. ...

Еще в разделе: (Показать все результаты (>153) - nuclphys.sinp.msu.ru/ )

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>6953) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• wLake program homepage