1. Ahlfors L.V. - Complex analysis ::
. ... Ahlfors L.V. - Complex analysis . ... : Complex analysis . : Ahlfors L.V. : . A standard source of information of functions of one complex variable, this text has retained its wide popularity in this field by being consistently rigorous without becoming needlessly concerned with advanced or overspecialized material. ... Complex function 21-48 . ... , 2004-2016 . ...
[
]
http://lib.mexmat.ru/books/3969 -- 95.2 -- 10.04.2016
:
(
(>21232) - lib.mexmat.ru/ )
2. About authors ot this complex
... Criteria of branch quality . As it was repeatedly told , phylogenetic trees consist from branches. ... I. e., those positions, which can separate sequences of the branch from other sequences in the alignment. ... Measure of branch separation . ... Here and further: A - branch of the tree, i , j - sequences of alignment . ... That's why number of conserved positions in some branch should be considered in complex with the distribution of conserved positions in the whole alignment. ...
[
]
http://mouse.belozersky.msu.ru/tools/svetka/articles/brancriteria.html -- 13.5 -- 09.06.2006
[
]
http://monkey.belozersky.msu.ru/~dian/svetka/articles/brancriteria.html -- 13.5 -- 09.06.2006
:
(
(>1413) - monkey.belozersky.msu.ru/ )
3. SAL- Numerical Analysis - Misc - Radix-2 Fast Fourier Transform
Radix-2 Fast Fourier Transform . The package performs the radix-2 FFT of a real or complex sequence, or sin/cos/complex Fourier integral of an evenly tabulated function. The input can be either real or complex with/without zero padding; you can request either the full complex transform, or only real/im/abs part of it. ... SAL Home | Numerical Analysis | Misc . ... SAL@KachinaTech.COM . ...
[
]
http://www.sai.msu.su/sal/B/0/RADIX2_FFT.html -- 3.7 -- 22.12.2007
:
(
(>3022) - www.sai.msu.su/ )
4. http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/179.pdf
NGS Data Analysis with Unipro UGENE Olga Golosova, Yuriy Vaskin, German Grekhov, Yuliya Algaer UNIPRO, Lavrentieva ave. ... That is where Unipro UGENE NGS framework comes in play. ... Moreover, the UGENE toolkit allows one to automate common tasks by creating workflows with the integrated tools using the UGENE Workflow Designer. Analysis of NGS data with UGENE may start, for example, from quality control of raw NGS data, received from a sequencing facility, with the integrated FastQC [3] tool. ...
[
]
http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/179.pdf -- 100.4 -- 15.06.2015
:
(
(>329) - mccmb.belozersky.msu.ru/ )
5. "A software complex for the analysis and visualization of monitoring and
... A software complex for the analysis and visualization of monitoring and forecast of data on climate changes" . ... Martynova Yu.V., Syshchenko S.P., Skvortsov A.V. A software complex for the analysis and visualization of monitoring and forecast of data on climate changes is considered. ... Keywords: climate change monitoring, information systems, Web-GIS technologies . ...
[
]
http://num-meth.srcc.msu.ru/english/zhurnal/tom_2013/v14r115.html -- 5.4 -- 28.01.2014
:
(
(>400) - num-meth.srcc.msu.ru/ )
6. Align tool for DNA-protein complexes
. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016
[
]
http://mouse.genebee.msu.ru/tools/StructAlign.html -- 5.0 -- 03.03.2016
:
(
(>31) - mouse.genebee.msu.ru/ )
7. Example of alignment
Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...
[
]
http://mouse.genebee.msu.ru/tools/LCexample.html -- 2.3 -- 20.06.2015
[
]
http://mouse.belozersky.msu.ru/tools/LCexample.html -- 2.3 -- 20.06.2015
:
(
(>6967) - mouse.belozersky.msu.ru/ )
8. MySQL Reference Manual for version 3.23.10-alpha. - H Description of MySQL
... A regular expression (regex) is a powerful way of specifying a complex search. MySQL uses regular Henry Spencer's inplementation of regular expressions. ... MySQL uses the extended version. This is a simplistic reference that skips the details. To get more exact information, see Henry Spencer's regex(7) manual page that is included in the source distribution. ... A regular expression describes a set of strings. The simplest regexp is one that has no special characters in it. ...
[
]
http://itpm.msu.su/mysql/Manual_chapter/manual_Regexp.html -- 9.7 -- 15.02.2000
:
(
(>495) - itpm.msu.su/ )
9. allpy: 505ce122068b lib/project.py
... 10 import sequence . ... 12 import allpy_data . ... 14 class Project ( object ): . ... 19 * alignment -- dict . ... 27 def __init__ ( self , * args ): . ... 31 Project(sequences, alignment) -> new Project with sequences and . ... 33 Project(fasta_file) -> new Project, read alignment and sequences . ... sequences , self . ... 97 >>> sequences,alignment=project.Project.get_from_fasta(open("test.fasta")) . ... 133 alignment [ sequences [ - 1 ]] = alignment_list . 134 return sequences , alignment . ...
[
]
http://kodomo.fbb.msu.ru/hg/allpy/file/505ce122068b/lib/project.py -- 31.8 -- 03.02.2013
:
(
(>112245) - kodomo.fbb.msu.ru/ )
10. Complex evaluator
CALCSYM - complex evaluator . ... CALCSYM.exe and CALCSYMi.exe will allow you to obtain numeric solution for *.out file generated by both CIRSYM and MATSYM programs (computation of freqency responces, unknowns, determinants, sensitivity analysis etc.. ... Setup file name for CALCSYM is "setup.cal". ... CALCSYMi.exe will allow you to work with long double over the range from 3.4*E-4932 to 3.4*E+4932. ... To calculate, run CALCSYM.exe and enter "file_name.OUT" or click on the "ENTER" (in "OUT" case). ...
[
]
http://astrometric.sai.msu.ru/~symbol/calcsym.html -- 2.6 -- 06.10.2004
:
(
(>14) - astrometric.sai.msu.ru/ )
11. Removing of blocking effect from video |
... . ... " " . ... MSU Graphics & Media Lab (Video Group) . The filter is intended for recovering visual quality of video ripped from DVD (for example, when it contains 4 hours of video data), VideoCD or after decompressing by H.261, H.263, H.264, DivX, XviD, etc. The algorithm decreases blocking artifacts, significantly improving visual quality of video. ... Filter for VirtualDub MSU Deblocking (68 KB, ZIP) . ...
[
]
http://graphics.cs.msu.ru/ru/science/research/videoqualityincreasing/deblock -- 16.5 -- 09.04.2016
:
(
(>325) - graphics.cs.msu.ru/ )
12. Writing wrapper definitions | PARALLEL.RU - -
... Writing wrapper definitions . ... Wrapper definitions themselves consist of C code with special macros. ... It is suggested that all identifiers declared outside functions end with _{{fileno}}. ... forallfn fn_name}}static int {{fn_name}}_ncalls_{{fileno}}; {{endforallfn}} might expand to: . ... Use vardecl to declare variables within a wrapper definition. ... With nested wrapper definitions, this also represents the point at which to insert the code for any inner nested functions. ... . ...
[
]
http://www.parallel.ru/docs/mpich/userguide/node73.html -- 22.7 -- 09.04.2016
:
(
(>691) - www.parallel.ru/ )
13. COMPLEX
Gnumeric . Prev . Next . ... COMPLEX(real,im[,suffix]) . ... @suffix 'i' 'j', COMPLEX #VALUE!. Excel. COMPLEX(1,-1) 1-i. Prev . ... COMBIN . ... CONCATENATE ...
[
]
http://uneex.mithril.cs.msu.su/static/GnumericDoc_ru/r2105.html -- 3.9 -- 26.09.2011
[
]
http://uneex.lorien.cs.msu.su/static/GnumericDoc_ru/r2105.html -- 3.9 -- 26.09.2011
:
(
(>874) - uneex.lorien.cs.msu.su/ )
14. Abstract
... Acoustic Nonlinearity, Attenuation and Scattering of a Sound in Water with Vapor-Gas Bubbles . ... Nonlinear effects, attenuation and scattering of a sound, originated in propagating of a sound in a liquid with vapor-gas bubbles, are investigated. A liquid with phase inclusions near to phase transition represents an example of complex media, when at determination of the acoustic characteristics it should take into account phase transformations. ...
[
]
http://acs366.phys.msu.su/isna16/Abstracts/AcousticNonlinearityAttenuationandScatteringofaSoundinWaterwithVaporGasBubbles.htm -- 7.1 -- 10.07.2002
:
(
(>220) - acs366.phys.msu.su/ )
15. Intelligent Systems :: Research :: :: Articles
... The main problem is increasing the recognition rate of some recognition engines, working in some restricted domains, such as telephone time-table question-answer systems and so on. ... Our algorithms allow user to get recognition variants, which are right sentences in some formal language. ... We suppose that BRE can produce a set of recognition variants in the form of the "complex chain". ... Length of complex chain is the number of vertexes in its graph. ... const*n^2 . ...
[
]
http://www.intsys.msu.ru/en/invest/speech/articles/lexers.htm -- 12.6 -- 09.04.2016
:
(
(>88) - www.intsys.msu.ru/ )
16. [Comphep-common] width and branching ratios in batch mode
... Previous message: [Comphep-common] Re: $COMPHEP/genEvents . Next message: [Comphep-common] Re: a bug in comphep b76i (windows version) . Messages sorted by: [ date ] [ thread ] [ subject ] [ author ] . Dear COMPHEP experts, Is it possible to evaluate width and branching ratios for a 1->2 process (for example ~1+ -> 2*x) in batch mode? ... More information about the Comphep-common mailing list . ...
[
]
http://theory.sinp.msu.ru/pipermail/comphep-common/2003/000108.html -- 3.8 -- 18.04.2013
:
(
(>1038) - theory.sinp.msu.ru/ )
17. Analysis of change-point synchronization in multi-channel EEG
Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... The number of randomly coinciding change-points (the noise level) can be easily estimated using the total numbers of change-points in each EEG channel, and thus the estimate of the number of systematically coinciding change-points can be cleared from the randomly coinciding change-points, both "true" and "false". ... This number, however, vary with the number of change-points in each channel. ...
[
]
http://brain.bio.msu.ru/papers/chp2000/10.htm -- 10.1 -- 03.06.2005
:
(
(>70) - brain.bio.msu.ru/ )
18. http://geo.web.ru/conf/alkaline/2009/Asavin2.htm
The existence of oceanic islands and seamounts is supposed to be the one of the main evidence of the plate tectonic theory. But there is no such acient geological object which could be so similar to rock complex of oceanic island. These structures must include the alkaline magmatism manifestation, sedimentary rocks close to recent riff limestone on the oceanic islands and sequence of terrigenic rocks. ... 100.00 . ... H 2 O calculated by the 100% norm of cations. d.l.. ...
[
]
http://geo.web.ru/conf/alkaline/2009/Asavin2.htm -- 110.8 -- 23.05.2009
:
(
(>740) - geo.web.ru/ )
19. Molecular design of polydentate complexing agents: from topological analysis to
... The paper, which is based upon plenary lecture presented at XVIII Tchugaev Conference on the Chemistry of Coordination Compounds (Moscow, 1996), reviews major steps of the molecular design of polydentate complexing agents with predefined properties (in particular, coordination stereochemistry). ... The consistent use of all three levels design tools is illustrated by the design of aminopolycarboxylate lanthanides chelators for prospective MRI (Magnetic Resonance Imaging) application. ...
[
]
http://www.chem.msu.ru/eng/publ/conc1.html -- 2.6 -- 27.02.2014
[
]
http://chem.msu.ru/eng/publ/conc1.html -- 2.6 -- 09.04.2016
:
(
(>1036) - chem.msu.ru/ )
20. Complex Types
. PHP Manual . Prev . Chapter 26. Source Layout . Next . Complex types such as arrays and objects require different treatment. Zend features a single API for these types - they're stored using hash tables. Note: To reduce complexity in the following source examples, we're only working with simple types such as integers at first. A discussion about creating more advanced types follows later in this chapter. Prev . Home . Next . String Handling . Up . PHP's Automatic Build System
[
]
http://old.hcs.cmc.msu.ru/php/zend.layout.complex-types.html -- 3.4 -- 03.02.2002
[
]
http://old.master.cmc.msu.ru/php/zend.layout.complex-types.html -- 3.4 -- 03.02.2002
[
]
http://oit.cmc.msu.ru/php/zend.layout.complex-types.html -- 3.4 -- 03.02.2002
:
(
(>1238) - oit.cmc.msu.ru/ )