. ћ . Наши юбиляры . љљљљљљљ љљљљљљљљљ . ћ Сотрудники отдела . ћ Наша научная работа . ћ Семинар по Звездной астрономии . ћ Конференции . ћ Общий Каталог Переменных Звезд . ћ Каталог рассеянных скоплений . ћ Московская школа звездной астрономии . ћ Юбилеи сотрудников . ћ Избранные публикации . ћ Педагогическая и популяризаторская деятельность . ћ Наши интернет-ресурсы и другие полезные ресурсы . ћ Ссылки на каталоги и базы данных . ћ Фотогалерея . Присылайте Ваши вопросы и комментарии Ольге Дурлевич

Еще в разделе: (Показать все результаты (>10291) - www.sai.msu.su/ )

• SAI SN RESEARCH GROUP
• APOD: 2007 March 19 - Galaxy Group Hickson 44
• SAL- Mathematics - Computer Algebra Systems - MAGMA

This home page belongs to small group of scientists working at . Sternberg Astronomical Institute which is a part of Moscow State University . ... Электронная библиотека научно-технической и художественной литературы (доступна только из ГАИШ) . ... Local staff . Dr. Edward Kononovich (konon -at- sai.msu.ru), Associate Professor . ... Dr. Sergey Ayukov (asv -at- sai.msu.ru), Research Fellow, Webmaster of the group . ... Joint seminar of Solar Studies Structure Group and Solar Photometry Group . ...

Еще в разделе: (Показать все результаты (>5437) - crydee.sai.msu.ru/ )

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>146) - bioinf.fbb.msu.ru/ )

• SDPlight
• SDPsite - PF07978
• SDPsite - PF01075

... There are two methods of describing plant associations of the lake-shore: visual and analytical. ... We analyzed each lake separately with help of cluster analysis (Manchattan distance, Ward method). ... Besides, cluster analysis only for common plant species was performed. ... All common species on this lake form one multitudinous cluster (fig. 5), except for Comarum palustre and Equisetum fluviatile (the same group of species reveled by cluster analysis for common species from other lakes). ...

Еще в разделе: (Показать все результаты (>369) - herba.msu.ru/ )

О лаборатории . ... Лаборатория теоретической биофизики . ... This Python module parses Gaussian cube files, produced by quite a few QM software packages, and makes volume data available as numpy array as well as some associated properties. ... Нет комментариев " Gaussian Cube files loader " . ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>61) - erg.biophys.msu.ru/ )

• Using Firefly/GAMESS-US efficiently ERG Research Group: Лаборатория
• Python membrane generator for MD simulations ERG Research Group: Лаборатория
• python ERG Research Group: Лаборатория теоретической биофизики

... positive_sign . ... The sign string precedes the quantity and currency_symbol . ... The sign string succeeds the quantity and currency_symbol . ... setlocale(LC_ALL, en_US ); $ locale_info = localeconv (); echo PRE \n ; echo --------------------------------------------\n ; echo Monetary information for current locale: \n ; echo --------------------------------------------\n\n ; echo int_curr_symbol: {$ locale_info [ int_curr_symbol ]}\n ; echo currency_symbol : {$ locale_info...

Еще в разделе: (Показать все результаты (>1516) - oit.cmc.msu.ru/ )

• number_format
• dio_stat
• strftime

... Topology inquiry functions . ... If a topology has been defined with one of the above functions, then the topology information can be looked up using inquiry functions. ... MPI_TOPO_TEST(comm, status) . ... OUT status] topology type of communicator comm (choice) . int MPI_Topo_test(MPI_Comm comm, int *status) . ... The function MPI_TOPO_TEST returns the type of topology that is assigned to a communicator. ... int MPI_Graphdims_get(MPI_Comm comm, int *nnodes, int *nedges) . ... Центры . ...

Еще в разделе: (Показать все результаты (>813) - www.parallel.ru/ )

• Intercommunicator Constructors | PARALLEL.RU - Информационно-аналитический
• MPI's Support for Libraries | PARALLEL.RU - Информационно-аналитический центр
• Group Accessors | PARALLEL.RU - Информационно-аналитический центр по

Электронная библиотека Попечительского совета . ... Miller G.A. - Groups Containing a Relatively Small Number of Sylow Subgroups . ... Название: Groups Containing a Relatively Small Number of Sylow Subgroups . Автор: Miller G.A. Язык: . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>26525) - lib.mexmat.ru/ )

• Rosenfeld A. - An introduction to algebraic structures :: Электронная
• Birman J.S. - Braids, Links, and Mapping Class Groups. :: Электронная
• Angles P. - Conformal Groups in Geometry and Spin Structures :: Электронная

SDPpred: a tool for prediction of amino acid residues that determine differences in functional specificity of homologous proteins . ... Amino acid residues that determine differences in protein functional specificity and account for correct recognition of interaction partners, are usually thought to correspond to those positions of a protein multiple alignment, where the distribution of amino acids is closely associated with grouping of proteins by specificity. ... As colored columns of the alignment. ...

Еще в разделе: (Показать все результаты (>5977) - monkey.belozersky.msu.ru/ )

• HF clusters: algorithm
• ETS numeration assumed
• About authors ot this complex

... Head of Biochemistry department, Corresponding Member of Russian Academy of Sciences, Doctor of Science . ... The first line of investigation, started in mid-1980s, deals with analysis of the structure and properties of proteins involved in regulation of contractile activity of different muscle (troponins I and T, caldesmon, calponin). ... The third direction of investigation deals with the investigation of the structure and properties of human small heat shock proteins. ... Biochemistry. ...

Еще в разделе: (Показать все результаты (>183) - biochem.bio.msu.ru/ )

• Biochemistry Department of Moscow State University | Mechanism of mitochondria

... Apache HTTP Server Version 2.0 . ... A single control process launches the number of child processes indicated by the NumServers directive at server startup. ... For each child process, Apache assesses the number of idle threads and creates or destroys threads to keep this number within the boundaries specified by MinSpareThreads and MaxSpareThreads . ... The User and Group directives are used to set the privileges of the Apache child processes. ... Maximum number of threads per child process . ...

Еще в разделе: (Показать все результаты (>1111) - uneex.lorien.cs.msu.su/ )

• What's in a package?
• mod_auth - Apache HTTP Server
• Selecting What to Verify, and How

... Apache HTTP Server Version 2.0 . ... A single control process launches the number of child processes indicated by the NumServers directive at server startup. ... For each child process, Apache assesses the number of idle threads and creates or destroys threads to keep this number within the boundaries specified by MinSpareThreads and MaxSpareThreads . ... The User and Group directives are used to set the privileges of the Apache child processes. ... Maximum number of threads per child process . ...

Еще в разделе: (Показать все результаты (>691) - itpm.msu.su/ )

• Creating a user
• Expiring News
• Installation

Astronomy Picture of the Day . Galaxy Group Hickson 44 . ... 19.03.2007 . ... Also known as the NGC 3190 Group, Hickson 44 contains several bright spiral galaxies and one bright elliptical galaxy on the upper left. ... Many galaxies in Hickson 44 and other compact groups are either slowly merging or gravitationally pulling each other apart. ... Publications with keywords: galaxies - group of galaxies . Publications with words: galaxies - group of galaxies . ... Galaxy NGC 474: Cosmic Blender . ...

Еще в разделе: (Показать все результаты (>23133) - www.astronet.ru/ )

• Астронет > Galaxy Group Hickson 44
• Hickson Compact Group 40
• Астронет > Hickson Compact Group 40

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>274) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• RNA secondary structure prediction

Network Working Group Request for Comments: 5612 Category: Informational P. Eronen Nokia D. Harrington Huawei Technologies (USA) August 2009 Enterprise Number for Documentation Use Abstract This document describes an Enterprise Number (also known as SMI Network Management Private Enterprise Code) for use in documentation. ... This Enterprise Number is not intended to be implemented. ... Eronen & Harrington Informational [Page 2] RFC 5612 Enterprise Number for Documentation Use August 2009 6. ...

Еще в разделе: (Показать все результаты (>24491) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc5612.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc785.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc785.txt.pdf

... You should add the following lines to your PC GAMESS/Firefly job: $ELDENS IEDEN=1 $END $ELPOT IEPOT=1 $END $CUBE CUBE=.T. mesh=coarse $END This will produce cube info for both density and ESP. You can choose to specify only $ELDENS or $ELPOT group, or both. ... Similarly, if $ELDENS group is provided with IEDEN = 1, MORB = 0 and the $CUBE group is provided with cube=.t., then a 3D "cube" of total density data will be punched. ... PC GAMESS v. 6.1 specific documentation . ...

Еще в разделе: (Показать все результаты (>125) - classic.chem.msu.su/ )

• Firefly/PC GAMESS DOCUMENTATION - NEW MP2 GRADIENT CODE
• PC GAMESS/Firefly DOCUMENTATION - SMP, multicore and HTT features
• Firefly Home Page

... Associating polyelectrolytes are macromolecules consisting of soluble charged groups and insoluble groups (stickers) distributed along the chain. ... 1] I.I. Potemkin, V.V. Vasilevskaya, A.R. Khokhlov, " Associating polyelectrolytes: Finite size cluster stabilization versus physical gel formation ", . ... 12] N.N. Oskolkov, I.I. Potemkin, " Complexation in asymmetric solutions of oppositely charged polyelectrolytes: Phase diagram ", Macromolecules 2007 , 40 , 8423-8429 . ... PSMTLab . ...

Еще в разделе: (Показать все результаты (>473) - polly.phys.msu.ru/ )

• Polymers with Associating Groups (experiment + theory + computer experiment) -
• Polymer and Soft Matter Theory Lab - Official Website
• Publications

... file . ... file log . ... 1 Using library in-place . ... 18 NEWS file . ... 21 NEWS file contains news that are important to the library users, not to the . ... It must contain a word abot every change in any interfaces. ... 23 contain a word about bugfix, if that bugfix was important and could cause users . ... 26 The file grows upwards (like blog, so that all the most important things are at . ... 38 * change(!): critical library interface change . 39 * change: change in the library interface . ...

Еще в разделе: (Показать все результаты (>37882) - kodomo.fbb.msu.ru/ )

• allpy: README.devel annotate
• allpy: ca2cf2377bed
• allpy: ca2cf2377bed allpy/markup.py

... Home > Scientific laboratories > IM . ... The Laboratory of Industrial Mathematics (LIM) headed by Professor V.M. Goloviznin was established in the Faculty of Computational Mathematics and Cybernetics (CMC) of Lomonosov Moscow State University in 2011. ... In the area of energy and space, examples of topical engineering problems LIM is involved in, include the numerical simulation of new-generation atomic plants and computational aeroacoustics. ... Source URL: http://en.cs.msu.ru/laboratories/im . ...

Еще в разделе: (Показать все результаты (>165) - en.cs.msu.ru/ )

• Laboratory of Industrial Mathematics | CMC MSU
• Department of English
• Laboratory of Programming Technologies

... Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures is very young. We have grown up in the laboratory of laser spectroscopy of water media. ... Use of such powerful modern tools of solution of inverse problems and problems of optimization provides successful solution of a wide range of applied problems of diagnostics and analysis of water media. ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...

Еще в разделе: (Показать все результаты (>40) - rswater.phys.msu.ru/ )