Документ взят из кэша поисковой машины. Адрес оригинального документа : http://kodomo.cmm.msu.ru/~alexus/projects/term_2_cr_1.doc Дата изменения: Tue Mar 17 08:03:09 2009 Дата индексирования: Tue Oct 2 13:25:35 2012 Кодировка: koi8-r

Михальченко Алексей
Зачетное задание по 1 блоку 2 семестра.


Мой белок называется «Molybdopterin biosynthesis protein moeB» (белок
moeB, биосинтезирующий молибдоптерин). Идентификатор - Moeb_Ecoli. P12282

Идентификаторы записей PDB: 1JW9, 1JWA, 1JWB.



Этот белок вовлечен в биосинтез кофактора молибдоптерина, необходимого
для молибдэнсодержащих ферментов. Также он грает роль в активации малой
субъединицы фактора превращения молибдоптерина.

Белок состоит из одной цепи, длина которой 249 аминокислотных остатков.
Масса цепи 26,719 Да. Согласно данным из UniProt элементы вторичной
структуры белка: 11 альфа-спиралей, 8 бета-тяжей, 3 бета-поворота.




[pic]

Пространственная структура белка



Последовательность белка в fasta-формате:



>sp|P12282|MOEB_ECOLI Molybdopterin biosynthesis protein moeB;

MAELSDQEMLRYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTL

LDFDTVSLSNLQRQTLHSDATVGQPKVESARDALTRINPHIAITPVNALLDDAELAALIA

EHDLVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQITVFTYQDGEPCYRCLSRLF

GENALTCVEAGVMAPLIGVIGSLQAMEAIKMLAGYGKPASGKIVMYDAMTCQFREMKLMR

NPGCEVCGQ

Организмом-хозяином для данного белка служит бактерия Escherichia coli
(strain K12). Вот ее систематика: Bacteria; Proteobacteria;
Gammaproteobacteria; Enterobacteriales; Enterobacteriaceae; Escherichia.



Ниже приведены ссылки на записи про белок:



UniProt - http://www.uniprot.org/uniprot/P12282

PDB - http://www.rcsb.org/pdb/explore.do?structureId=1JW9

SRS - http://srs.ebi.ac.uk/srsbin/cgi-bin/wgetz?-id+3uOgV1ZRa7j+-
e+[SWISSPROT:'MOEB_ECOLI']+-qnum+2+-enum+1



Статьи про белок:




Cloning and sequencing of the Escherichia coli chlEN operon involved in
molybdopterin biosynthesis.

Nohno T, Kasai Y, Saito T.
Department of Pharmacology, Kawasaki Medical School, Kurashiki, Japan.
The nucleotide sequence of a HinPI-HpaII restriction nuclease fragment
which complemented a delta chlE strain of Escherichia coli was determined.
Two open reading frames were deduced to be the structural genes for ChlE
and ChlN proteins, which have molecular weights of 44,067 and 26,719,
respectively. Both proteins were required for complementing a chromosomal
deletion of the chlE locus. The chlE and chlN genes were transcribed from a
common promoter, chlEp, located upstream of chlE. Transcriptional and
translational signal sequences were recognized in this region.


A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to
the 12.7-28.0 min region on the linkage map.

Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T,
Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K,
Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H,
Nishio Y, Saito N, Horiuchi T, et al.
Institute of Medical Science, University of Tokyo, Japan.
The 718,122 base pair sequence of the Escherichia coli K-12 genome
corresponding to the region from 12.7 to 28.0 minutes on the genetic map is
described. This region contains at least 681 potential open reading frames,
of which 277 (41%) have been previously identified, 147 (22%) are
homologous to other known genes, 139 (20%) are identical or similar to the
hypothetical genes registered in databases, and the remaining 118 (17%) do
not show a significant similarity to any other gene. In this region, we
assigned a cluster of cit genes encoding multienzyme citrate lyase, two
clusters of fimbrial genes and a set of lysogenic phage genes encoding
integrase, excisionase and repressor in the e14 genetic element. In
addition, a new valine tRNA gene, designated valZ, and a family of long
directly repeated sequences, LDR-A, -B and -C, were found.


The complete genome sequence of Escherichia coli K-12.

Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M,
Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW,
Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y.
Laboratory of Genetics, University of Wisconsin-Madison, 445 Henry Mall,
Madison, WI 53706, USA. ecoli@genetics.wisc.edu
The 4,639,221-base pair sequence of Escherichia coli K-12 is presented. Of
4288 protein-coding genes annotated, 38 percent have no attributed
function. Comparison with five other sequenced microbes reveals ubiquitous
as well as narrowly distributed gene families; many families of similar
genes within E. coli are also evident. The largest family of paralogous
proteins contains 80 ABC transporters. The genome as a whole is strikingly
organized with respect to the local direction of replication; guanines,
oligonucleotides possibly related to replication and recombination, and
most genes are so oriented. The genome also contains insertion sequence
(IS) elements, phage remnants, and many other patches of unusual
composition indicating genome plasticity through horizontal transfer.


Highly accurate genome sequences of Escherichia coli K-12 strains MG1655
and W3110.

Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E,
Baba T, Wanner BL, Mori H, Horiuchi T.
Division of Genome Dynamics, National Institute for Basic Biology,
Myodaiji, Okazaki, Aichi Pref., Japan.
With the goal of solving the whole-cell problem with Escherichia coli K-12
as a model cell, highly accurate genomes were determined for two closely
related K-12 strains, MG1655 and W3110. Completion of the W3110 genome and
comparison with the MG1655 genome revealed differences at 267 sites,
including 251 sites with short, mostly single-nucleotide, insertions or
deletions (indels) or base substitutions (totaling 358 nucleotides), in
addition to 13 sites with an insertion sequence element or defective
prophage in only one strain and two sites for the W3110 inversion. Direct
DNA sequencing of PCR products for the 251 regions with short indel and
base disparities revealed that only eight sites are true differences. The
other 243 discrepancies were due to errors in the original MG1655 sequence,
including 79 frameshifts, one amino-acid residue deletion, five amino-acid
residue insertions, 73 missense, and 17 silent changes within coding
regions. Errors in the original MG1655 sequence (<1 per 13,000 bases) were
mostly within portions sequenced with out-dated technology based on
radioactive chemistry.